Gevas PowerPoint PPT Presentations

All Time
Show:
Recommended
Sort by:
GEVAS BILIM TEKNOLOJILERI PROJESI PowerPoint PPT Presentation
GEVAS BILIM TEKNOLOJILERI PROJESI - Title: PowerPoint Presentation Last modified by: Administrator Created Date: 1/1/1601 12:00:00 AM Document presentation format: Ekran G sterisi Other titles
Title: PowerPoint Presentation Last modified by: Administrator Created Date: 1/1/1601 12:00:00 AM Document presentation format: Ekran G sterisi Other titles
| PowerPoint PPT presentation | free to download
LE GEVAS CO Fondement et perspectives PowerPoint PPT Presentation
LE GEVAS CO Fondement et perspectives - LE GEVAS CO Fondement et perspectives Maximin ASTOURNE IEN ASH/CT Le GEVA-Sco : fondement et perspectives Pourquoi le GEVA-sco ? Passer d une logique de demande ...
LE GEVAS CO Fondement et perspectives Maximin ASTOURNE IEN ASH/CT Le GEVA-Sco : fondement et perspectives Pourquoi le GEVA-sco ? Passer d une logique de demande ...
| PowerPoint PPT presentation | free to download
Levelezo program be PowerPoint PPT Presentation
Levelezo program be - Outlook Express program Mir l is lesz sz ? A levelez program haszn latba v tele: Mi rt is j a levelez program haszn lata? Milyen adatok kellenek a ...
Outlook Express program Mir l is lesz sz ? A levelez program haszn latba v tele: Mi rt is j a levelez program haszn lata? Milyen adatok kellenek a ...
| PowerPoint PPT presentation | free to view
PowerPoint Sunusu PowerPoint PPT Presentation
PowerPoint Sunusu - STOP PKK-KADEK !!! STOP KONGRA-GEL !!! PKK - KADEK & KONGRA - GEL MUST CLOSED !!! For many years, Turkey has suffered from terrorism that has never been experienced ...
STOP PKK-KADEK !!! STOP KONGRA-GEL !!! PKK - KADEK & KONGRA - GEL MUST CLOSED !!! For many years, Turkey has suffered from terrorism that has never been experienced ...
| PowerPoint PPT presentation | free to view
NSVL- ENSV PowerPoint PPT Presentation
NSVL- ENSV - Title: PowerPoint Presentation Last modified by: home Created Date: 1/1/1601 12:00:00 AM Document presentation format: Other titles: Times New Roman ...
Title: PowerPoint Presentation Last modified by: home Created Date: 1/1/1601 12:00:00 AM Document presentation format: Other titles: Times New Roman ...
| PowerPoint PPT presentation | free to download
ALATI KAUNIS PowerPoint PPT Presentation
ALATI KAUNIS - ... sopivan iso, halpa Noored ohkavad: ... Tarto on vain mukava paikka Sest siin on hea ja rahulik Gute standart Hansalinn, ...
... sopivan iso, halpa Noored ohkavad: ... Tarto on vain mukava paikka Sest siin on hea ja rahulik Gute standart Hansalinn, ...
| PowerPoint PPT presentation | free to view
Industrial Applications of Neuro-Fuzzy Networks PowerPoint PPT Presentation
Industrial Applications of Neuro-Fuzzy Networks - Industrial Applications of Neuro-Fuzzy Networks
Industrial Applications of Neuro-Fuzzy Networks
| PowerPoint PPT presentation | free to download
Kui laps elab kiitusega, PowerPoint PPT Presentation
Kui laps elab kiitusega, - ... Markus Hansson Walter ... Kaisa-Kriki Kais Gerhard Lindt Anett Alamets Markus Hansson Sirle Allikivi Elisabeth Proos Richard Voogel Iris Epp ...
... Markus Hansson Walter ... Kaisa-Kriki Kais Gerhard Lindt Anett Alamets Markus Hansson Sirle Allikivi Elisabeth Proos Richard Voogel Iris Epp ...
| PowerPoint PPT presentation | free to download
????????? IVF PowerPoint PPT Presentation
????????? IVF - Bulgarian Biologia et Immunologia Reproductiones - 1979 ... ?????????????? ? ????????????, ????? ? ?????????? ?????????? ???? zona pellucida ...
Bulgarian Biologia et Immunologia Reproductiones - 1979 ... ?????????????? ? ????????????, ????? ? ?????????? ?????????? ???? zona pellucida ...
| PowerPoint PPT presentation | free to download
Do toxins trigger autistic regression? PowerPoint PPT Presentation
Do toxins trigger autistic regression? - Do toxins trigger autistic regression? McGinnis WR, Miller VM, Audya T and Edelson S. Neurotoxic brainstem impairment as proposed threshold event in autistic regression.
Do toxins trigger autistic regression? McGinnis WR, Miller VM, Audya T and Edelson S. Neurotoxic brainstem impairment as proposed threshold event in autistic regression.
| PowerPoint PPT presentation | free to download
Connectionist Knowledge Representation and Reasoning (Part I) PowerPoint PPT Presentation
Connectionist Knowledge Representation and Reasoning (Part I) - Title: Intelligent Systems on the World Wide Web OWL Author: Marc Ehrig Last modified by: barbara Created Date: 4/30/2003 10:00:19 AM
Title: Intelligent Systems on the World Wide Web OWL Author: Marc Ehrig Last modified by: barbara Created Date: 4/30/2003 10:00:19 AM
| PowerPoint PPT presentation | free to view
Betriebspraktika im 9. Jg. PowerPoint PPT Presentation
Betriebspraktika im 9. Jg. - Betriebspraktika im 9. Jg. Begegnung mit der Arbeitswelt
Betriebspraktika im 9. Jg. Begegnung mit der Arbeitswelt
| PowerPoint PPT presentation | free to download
KULDTAIP 2005 PowerPoint PPT Presentation
KULDTAIP 2005 - Title: PowerPoint Presentation Author: triibu Last modified by: triibu Created Date: 10/6/2004 4:37:10 PM Document presentation format: On-screen Show
Title: PowerPoint Presentation Author: triibu Last modified by: triibu Created Date: 10/6/2004 4:37:10 PM Document presentation format: On-screen Show
| PowerPoint PPT presentation | free to download
Oscillation patterns in biological networks PowerPoint PPT Presentation
Oscillation patterns in biological networks - p53 system - regulates apoptosis in mammalian cells after strong DNA damage ... Circadian oscillations in cyanobacteria. Ken-Ichi Kucho et al. Journ. Bacteriol. ...
p53 system - regulates apoptosis in mammalian cells after strong DNA damage ... Circadian oscillations in cyanobacteria. Ken-Ichi Kucho et al. Journ. Bacteriol. ...
| PowerPoint PPT presentation | free to view
Example of Modeling Signal Transduction Systems PowerPoint PPT Presentation
Example of Modeling Signal Transduction Systems - Example of Modeling Signal Transduction Systems Julie Dickerson
Example of Modeling Signal Transduction Systems Julie Dickerson
| PowerPoint PPT presentation | free to download
Investigation of Tetrahedral Symmetry in Nuclei PowerPoint PPT Presentation
Investigation of Tetrahedral Symmetry in Nuclei - Universa Universis Patavina Libertas Decay spectroscopy of neutron-rich Lead isotopes A. Gottardo, J.J. Valiente-Dobon, G. Benzoni, R. Nicolini
Universa Universis Patavina Libertas Decay spectroscopy of neutron-rich Lead isotopes A. Gottardo, J.J. Valiente-Dobon, G. Benzoni, R. Nicolini
| PowerPoint PPT presentation | free to download
L PowerPoint PPT Presentation
L - ... alaealiste vastu suunatud kuriteod, perev givallakuriteod) P hja Ringkonnaprokuratuuris alaealiste osakond (vanemprokur r, 2 ringkonnaprokur ri, ...
... alaealiste vastu suunatud kuriteod, perev givallakuriteod) P hja Ringkonnaprokuratuuris alaealiste osakond (vanemprokur r, 2 ringkonnaprokur ri, ...
| PowerPoint PPT presentation | free to download
Jean-Yves Barreyre PowerPoint PPT Presentation
Jean-Yves Barreyre - Title: Construire un diagnostic territorial partag Autisme en Ile de France Author: Jean-Yves BARREYRE Last modified by: Jean-Yves BARREYRE Created Date
Title: Construire un diagnostic territorial partag Autisme en Ile de France Author: Jean-Yves BARREYRE Last modified by: Jean-Yves BARREYRE Created Date
| PowerPoint PPT presentation | free to view
quanta PowerPoint PPT Presentation
quanta - ... Andrew Houck, Steve Huang, Murali Kota, Geva Patz, Matthias Steffen, Andrew ... MIT Center for Bits and Atoms. Fundamental Principles. 1. Information has a ...
... Andrew Houck, Steve Huang, Murali Kota, Geva Patz, Matthias Steffen, Andrew ... MIT Center for Bits and Atoms. Fundamental Principles. 1. Information has a ...
| PowerPoint PPT presentation | free to download
Devenir%20lecteur PowerPoint PPT Presentation
Devenir%20lecteur - a. Par reconnaissance ' logographique ' (le mot comme un objet) ... professeurs, les incitant apr s administrer eux-m mes, des valuations de ces comp tences chez des enfants ...
a. Par reconnaissance ' logographique ' (le mot comme un objet) ... professeurs, les incitant apr s administrer eux-m mes, des valuations de ces comp tences chez des enfants ...
| PowerPoint PPT presentation | free to download
Two - Component Signal Transduction PowerPoint PPT Presentation
Two - Component Signal Transduction - Two - Component Signal Transduction modular stimulas-response systems Response Regulator: conserved receiver domain + specific effecter domain Histidine Kinase Sensor ...
Two - Component Signal Transduction modular stimulas-response systems Response Regulator: conserved receiver domain + specific effecter domain Histidine Kinase Sensor ...
| PowerPoint PPT presentation | free to download
Eric%20Plummer PowerPoint PPT Presentation
Eric%20Plummer - For each training method, data series, and architecture, 3 candidates were trained ... One training method did not appear to be clearly better ...
For each training method, data series, and architecture, 3 candidates were trained ... One training method did not appear to be clearly better ...
| PowerPoint PPT presentation | free to download
Preschool teacher PowerPoint PPT Presentation
Preschool teacher - Preschool teacher s evaluation on non-native children s coping in Estonian-speaking kindergarten and ... The State Programme
Preschool teacher s evaluation on non-native children s coping in Estonian-speaking kindergarten and ... The State Programme
| PowerPoint PPT presentation | free to view
Virtual Neighborhoods Architecture of Online Communities PowerPoint PPT Presentation
Virtual Neighborhoods Architecture of Online Communities - Community works with broadcast medium: Most efficient connection: No interactions ... Leading to social influence & limitation in attitudes, knowledge & behavior ...
Community works with broadcast medium: Most efficient connection: No interactions ... Leading to social influence & limitation in attitudes, knowledge & behavior ...
| PowerPoint PPT presentation | free to download
SOO - JA RABATAIMED PowerPoint PPT Presentation
SOO - JA RABATAIMED - SOO - JA RABATAIMED Lisamaterjal 2. klassile Lea Lints Lustivere P hikool J geva maakond Koolitaja: Kalle Kolberg J hvikas Rahvap rased nimed: kuremari, rabamari ...
SOO - JA RABATAIMED Lisamaterjal 2. klassile Lea Lints Lustivere P hikool J geva maakond Koolitaja: Kalle Kolberg J hvikas Rahvap rased nimed: kuremari, rabamari ...
| PowerPoint PPT presentation | free to download
Systematic Use of Mother Tongue in Target Language Classrooms PowerPoint PPT Presentation
Systematic Use of Mother Tongue in Target Language Classrooms - Systematic Use of Mother Tongue in Target Language Classrooms He An E Department of English The Hong Kong Institute of Education Systematic use of MT Taking advantage ...
Systematic Use of Mother Tongue in Target Language Classrooms He An E Department of English The Hong Kong Institute of Education Systematic use of MT Taking advantage ...
| PowerPoint PPT presentation | free to view
The regulation of p53 dynamics in response to DNA damage PowerPoint PPT Presentation
The regulation of p53 dynamics in response to DNA damage - The regulation of p53 dynamics in response to DNA damage ... Wip1 identified as the putative inhibtor. Inhibitor should initially be at relatively low levels ...
The regulation of p53 dynamics in response to DNA damage ... Wip1 identified as the putative inhibtor. Inhibitor should initially be at relatively low levels ...
| PowerPoint PPT presentation | free to view
Bibliograf PowerPoint PPT Presentation
Bibliograf - ... Delors, J. et al
... Delors, J. et al
| PowerPoint PPT presentation | free to download
ESOL students in Language Arts PowerPoint PPT Presentation
ESOL students in Language Arts - What are effective teaching strategies? ... English Language Learner ESL: English as a Second Language Learner (English not always the 2nd but 3rd or 4th) ...
What are effective teaching strategies? ... English Language Learner ESL: English as a Second Language Learner (English not always the 2nd but 3rd or 4th) ...
| PowerPoint PPT presentation | free to view
Neuroinformatics PowerPoint PPT Presentation
Neuroinformatics - meinauto(X) :- left(Y,X),holl ndisch(Y),rot(Y) ... Holographic reduced representation [Plate, 95] circular correlation/convolution ...
meinauto(X) :- left(Y,X),holl ndisch(Y),rot(Y) ... Holographic reduced representation [Plate, 95] circular correlation/convolution ...
| PowerPoint PPT presentation | free to view
Essay Submitted by PowerPoint PPT Presentation
Essay Submitted by - Premature ovarian failure (POF) is generally irreversible. ... the antral stage are reported in POF and anti-M llerian hormone (AMH) might be ...
Premature ovarian failure (POF) is generally irreversible. ... the antral stage are reported in POF and anti-M llerian hormone (AMH) might be ...
| PowerPoint PPT presentation | free to view
Example of Modeling Signal Transduction Systems PowerPoint PPT Presentation
Example of Modeling Signal Transduction Systems - Samples can either be fluorescing in their natural form like chlorophyll and ... Usually, cellular components do not fluoresce themselves. ...
Samples can either be fluorescing in their natural form like chlorophyll and ... Usually, cellular components do not fluoresce themselves. ...
| PowerPoint PPT presentation | free to download
Optimizing Drug Design PowerPoint PPT Presentation
Optimizing Drug Design - Inhibition measured by Marta Rosin (Novartis' Excellon) , Hebrew University School of Pharmacy ... Prof. Marta Rosin HUJI, AChE inhibitors. Optimizing Drug ...
Inhibition measured by Marta Rosin (Novartis' Excellon) , Hebrew University School of Pharmacy ... Prof. Marta Rosin HUJI, AChE inhibitors. Optimizing Drug ...
| PowerPoint PPT presentation | free to download
Analysis of AccuForm Management PowerPoint PPT Presentation
Analysis of AccuForm Management - Coating Industry Profile. 82% of Americans wanted ... The growth of China's apparel market was up to 19.6 ... Industry standard should be strictly carried out. ...
Coating Industry Profile. 82% of Americans wanted ... The growth of China's apparel market was up to 19.6 ... Industry standard should be strictly carried out. ...
| PowerPoint PPT presentation | free to view
Work related diseases and training element PowerPoint PPT Presentation
Work related diseases and training element - Self-employed entrepreneurs 33. Results (continued) of obj. II. Training ... should have a license from the Estonian Health Insurance Fund to be able to ...
Self-employed entrepreneurs 33. Results (continued) of obj. II. Training ... should have a license from the Estonian Health Insurance Fund to be able to ...
| PowerPoint PPT presentation | free to view
HDAP: Three Programs CSE, DPE, SCCP PowerPoint PPT Presentation
HDAP: Three Programs CSE, DPE, SCCP - School and Clinical. Child Psychology. Program Chair: Peterson-Badali ... School & Clinical Child Psychology ... in both school and child clinical psychology. ...
School and Clinical. Child Psychology. Program Chair: Peterson-Badali ... School & Clinical Child Psychology ... in both school and child clinical psychology. ...
| PowerPoint PPT presentation | free to view
Learning expedition to Vrska PowerPoint PPT Presentation
Learning expedition to Vrska - On June 16 - 18 1998 the students and teachers from 21 Estonian GLOBE schools ... Biometry. with GLOBE techniques and in a traditional manner of foresters ...
On June 16 - 18 1998 the students and teachers from 21 Estonian GLOBE schools ... Biometry. with GLOBE techniques and in a traditional manner of foresters ...
| PowerPoint PPT presentation | free to view
Schulprogramm PowerPoint PPT Presentation
Schulprogramm - Schulprogramm Ganztags-Hauptschule Welver ffnung von Schule Tag der offenen T r Teilnahme am Gemeindeleben Au erschulische Unterrichtsveranstaltungen Tag der ...
Schulprogramm Ganztags-Hauptschule Welver ffnung von Schule Tag der offenen T r Teilnahme am Gemeindeleben Au erschulische Unterrichtsveranstaltungen Tag der ...
| PowerPoint PPT presentation | free to view
Objective Function Based Fuzzy Clustering PowerPoint PPT Presentation
Objective Function Based Fuzzy Clustering - gives the shape of the cluster i, by adding it to the distance calculation, it ... Cluster Merging I. This method is compatible with the objective function. ...
gives the shape of the cluster i, by adding it to the distance calculation, it ... Cluster Merging I. This method is compatible with the objective function. ...
| PowerPoint PPT presentation | free to view
Myom ve infertilite PowerPoint PPT Presentation
Myom ve infertilite - Clinically relevant fibroids (uterine enlargement greater than or equal to nine weeks size, fibroid greater than or equal to 4 cm, or submucosal fibroid) ...
Clinically relevant fibroids (uterine enlargement greater than or equal to nine weeks size, fibroid greater than or equal to 4 cm, or submucosal fibroid) ...
| PowerPoint PPT presentation | free to view
Literal and ProRulext: Algorithms for Rule Extraction of ANNs PowerPoint PPT Presentation
Literal and ProRulext: Algorithms for Rule Extraction of ANNs - And, kinds of non-linear activation functions (sigmoid and hyperbolic tangent). 3. Experiments ... where: Sig Sigmoid, Tan Hyperbolic Tangent, Irr non ...
And, kinds of non-linear activation functions (sigmoid and hyperbolic tangent). 3. Experiments ... where: Sig Sigmoid, Tan Hyperbolic Tangent, Irr non ...
| PowerPoint PPT presentation | free to download
Successful Reading Instruction Strategies for English Language Learners PowerPoint PPT Presentation
Successful Reading Instruction Strategies for English Language Learners - ... not understand common idioms such as 'make up your mind,' 'let's hit the books,' etc. ... Make sure the text you are using is at the independent or ...
... not understand common idioms such as 'make up your mind,' 'let's hit the books,' etc. ... Make sure the text you are using is at the independent or ...
| PowerPoint PPT presentation | free to view
The National Literacy Panel for Language Minority Children and Youth Center for Applied Linguistics SRI International PowerPoint PPT Presentation
The National Literacy Panel for Language Minority Children and Youth Center for Applied Linguistics SRI International - Relationship Between Oral Language Proficiency and Literacy: Fred Genesee and Esther Geva ... Advisors: Sandra Baxter, Phoebe Cottingham, Gil Garcia, Peggy ...
Relationship Between Oral Language Proficiency and Literacy: Fred Genesee and Esther Geva ... Advisors: Sandra Baxter, Phoebe Cottingham, Gil Garcia, Peggy ...
| PowerPoint PPT presentation | free to view
Clinical epigenetics and its relation to ART PowerPoint PPT Presentation
Clinical epigenetics and its relation to ART - study of changes in gene expression that occur without ... epigenesis. Epigenetic. variation. genotype. space. phenotype. space. G. J. A. Z. early embryo ...
study of changes in gene expression that occur without ... epigenesis. Epigenetic. variation. genotype. space. phenotype. space. G. J. A. Z. early embryo ...
| PowerPoint PPT presentation | free to view
Connectionist Knowledge Representation and Reasoning Part I PowerPoint PPT Presentation
Connectionist Knowledge Representation and Reasoning Part I - Recursive data structures. The general idea: recursive distributed representations ... Recursive data structures. The general idea: recursive distributed ...
Recursive data structures. The general idea: recursive distributed representations ... Recursive data structures. The general idea: recursive distributed ...
| PowerPoint PPT presentation | free to view
La politique du handicap PowerPoint PPT Presentation
La politique du handicap - de contribuer au financement de la prise en charge de la perte d'autonomie des ... dans le respect de l' galit de traitement des personnes concern es sur ...
de contribuer au financement de la prise en charge de la perte d'autonomie des ... dans le respect de l' galit de traitement des personnes concern es sur ...
| PowerPoint PPT presentation | free to view
Complex networks are found throughout biology PowerPoint PPT Presentation
Complex networks are found throughout biology - Complex networks are found throughout biology
Complex networks are found throughout biology
| PowerPoint PPT presentation | free to view
Unsupervised Optimal Fuzzy Clustering PowerPoint PPT Presentation
Unsupervised Optimal Fuzzy Clustering - IEEE Transactions on Pattern Analysis and Machine Intelligence, ... L = fuzzy subset of L: L = {all potable liquids} 8. Clustering is a mathematical tool that ...
IEEE Transactions on Pattern Analysis and Machine Intelligence, ... L = fuzzy subset of L: L = {all potable liquids} 8. Clustering is a mathematical tool that ...
| PowerPoint PPT presentation | free to view
LAccompagnement domicile de personnes en situation de handicap psychique PowerPoint PPT Presentation
LAccompagnement domicile de personnes en situation de handicap psychique - S minaire MiRe Qualit de l'aide domicile. Accompagner une personne ... Le cas du SAD de Dunkerque (Bailleul) depuis 1998... Un partenariat : ...
S minaire MiRe Qualit de l'aide domicile. Accompagner une personne ... Le cas du SAD de Dunkerque (Bailleul) depuis 1998... Un partenariat : ...
| PowerPoint PPT presentation | free to view
PostGenomics Technologies PowerPoint PPT Presentation
PostGenomics Technologies - ARC6 Is a J-Domain Plastid Division Protein and an Evolutionary Descendant of ... SALRRIQL*AICLDFNKILLGYRIHWLCLLLHLHVIIVSNFTHFSWMLRKERELMGFCGFKL*SSQELSHWFTVA LYV ...
ARC6 Is a J-Domain Plastid Division Protein and an Evolutionary Descendant of ... SALRRIQL*AICLDFNKILLGYRIHWLCLLLHLHVIIVSNFTHFSWMLRKERELMGFCGFKL*SSQELSHWFTVA LYV ...
| PowerPoint PPT presentation | free to view
Tal Geva, MD PowerPoint PPT Presentation
Tal Geva, MD - Overview of Progress in Pediatric Cardiology. Food and Drug Administration ... understanding of anatomy, embryology, genetics, pathophysiology, and natural history ...
Overview of Progress in Pediatric Cardiology. Food and Drug Administration ... understanding of anatomy, embryology, genetics, pathophysiology, and natural history ...
| PowerPoint PPT presentation | free to view
English Language Learners in Language Arts PowerPoint PPT Presentation
English Language Learners in Language Arts - What are characteristics of second language learning vs. foreign language learning? ... pattern and same pronunciation (boot, moon, loon, spoon, spooling, spooled) ...
What are characteristics of second language learning vs. foreign language learning? ... pattern and same pronunciation (boot, moon, loon, spoon, spooling, spooled) ...
| PowerPoint PPT presentation | free to view
Text Search for Finegrained Semistructured Data PowerPoint PPT Presentation
Text Search for Finegrained Semistructured Data - Title of books containing some para mentioning both 'sailing' and 'windsurfing' ... contains($p,'windsurfing')) RETURN $b/title ...
Title of books containing some para mentioning both 'sailing' and 'windsurfing' ... contains($p,'windsurfing')) RETURN $b/title ...
| PowerPoint PPT presentation | free to download
Sin t PowerPoint PPT Presentation
Sin t - FACTORES DE RIESGO ASOCIADOS A ENFERMEDAD ARTERIAL PERIF RICA DEFINIDA POR EL NDICE TOBILLO-BRAZO EN MUJERES. Julio A. Carbayo, Juan L pez-Abril, Enrique L pez ...
FACTORES DE RIESGO ASOCIADOS A ENFERMEDAD ARTERIAL PERIF RICA DEFINIDA POR EL NDICE TOBILLO-BRAZO EN MUJERES. Julio A. Carbayo, Juan L pez-Abril, Enrique L pez ...
| PowerPoint PPT presentation | free to download
10 years with GLOBE program PowerPoint PPT Presentation
10 years with GLOBE program - 10 years with GLOBE program
10 years with GLOBE program
| PowerPoint PPT presentation | free to view
High Performance Database Lab PowerPoint PPT Presentation
High Performance Database Lab - Supervisor:Prof. Shan Wang. School of information, Renmin University of China ... Vera Watson. Jim Gray. Donald D. Chamberlin. A103. A102. A101. a1. a2. a3 ...
Supervisor:Prof. Shan Wang. School of information, Renmin University of China ... Vera Watson. Jim Gray. Donald D. Chamberlin. A103. A102. A101. a1. a2. a3 ...
| PowerPoint PPT presentation | free to view


Home About Us Terms and Conditions Privacy Policy Contact Us
Copyright 2025 CrystalGraphics, Inc. — All rights Reserved. PowerShow.com is a trademark of CrystalGraphics, Inc.
gevas — Search results on PowerShow.com