672 Plastid PPTs View free & download

Plastid genomes PowerPoint PPT Presentation

Plastid genomes - The most important are the chloroplasts. ... Polyphyletic (Reptiles) NODE. BRANCH. Phylogeny Estimation. Branch-and-Bound. Least Squares ...

The most important are the chloroplasts. ... Polyphyletic (Reptiles) NODE. BRANCH. Phylogeny Estimation. Branch-and-Bound. Least Squares ...

| PowerPoint PPT presentation | free to view

Endosymbiotic origin of mitochondria and plastids PowerPoint PPT Presentation

Endosymbiotic origin of mitochondria and plastids - Endosymbiotic origin of mitochondria and plastids Polycistronic mRNAs Prokaryotic like mRNA in plastid Comparison of genome sizes Huge variation in size of ...

Endosymbiotic origin of mitochondria and plastids Polycistronic mRNAs Prokaryotic like mRNA in plastid Comparison of genome sizes Huge variation in size of ...

| PowerPoint PPT presentation | free to view

Endosymbiotic origin of mitochondria and plastids - Endosymbiotic origin of mitochondria and plastids Polycistronic mRNAs Prokaryotic like mRNA in plastid Comparison of genome sizes Huge variation in size of ...

Endosymbiotic origin of mitochondria and plastids Polycistronic mRNAs Prokaryotic like mRNA in plastid Comparison of genome sizes Huge variation in size of ...

| PowerPoint PPT presentation | free to view

Sizes of (plastid) cpDNA PowerPoint PPT Presentation

Sizes of (plastid) cpDNA - Sizes of (plastid) cpDNA Range is 70,000 bp (70 kb) to ~2,000,000 bp (2,000 kb), but most are less than 250,000 bp (250 kb) Land plants typically 120 170 kb

Sizes of (plastid) cpDNA Range is 70,000 bp (70 kb) to ~2,000,000 bp (2,000 kb), but most are less than 250,000 bp (250 kb) Land plants typically 120 170 kb

| PowerPoint PPT presentation | free to download

Eukaryotic Membranes: Plastids and Vacuoles PowerPoint PPT Presentation

Eukaryotic Membranes: Plastids and Vacuoles - Central vacuole in plants is for support and storage of metabolic wastes ... 2. Cell movement the assembly, disassembly, and sliding of microfilaments and ...

Central vacuole in plants is for support and storage of metabolic wastes ... 2. Cell movement the assembly, disassembly, and sliding of microfilaments and ...

| PowerPoint PPT presentation | free to download

Sizes of plastid cpDNA - Sizes of (plastid) cpDNA ... Sizes of cpDNAs from diverse plants. From ... Rumpho, M.E., Summer, E.J. & Manhart, J.R. (2000) Solar-Powered Sea Slugs. ...

Sizes of (plastid) cpDNA ... Sizes of cpDNAs from diverse plants. From ... Rumpho, M.E., Summer, E.J. & Manhart, J.R. (2000) Solar-Powered Sea Slugs. ...

| PowerPoint PPT presentation | free to view

The plastid clpP1 protease gene is essential for plant development PowerPoint PPT Presentation

The plastid clpP1 protease gene is essential for plant development - Title: Slide 1 Author: Michelle Last modified by: kumi2la Created Date: 4/16/2004 6:23:50 AM Document presentation format: On-screen Show Other titles

Title: Slide 1 Author: Michelle Last modified by: kumi2la Created Date: 4/16/2004 6:23:50 AM Document presentation format: On-screen Show Other titles

| PowerPoint PPT presentation | free to download

Sizes of plastid cpDNA - Sizes of cpDNAs from diverse plants. From Kloppstech, Westhof et al. ... ancient algae, such as reds (rhodophytes) or chromophytes (Chl a/c ...

Sizes of cpDNAs from diverse plants. From Kloppstech, Westhof et al. ... ancient algae, such as reds (rhodophytes) or chromophytes (Chl a/c ...

| PowerPoint PPT presentation | free to view

Potato plastidic and nuclear DNA evolution and its relation to species evolution PowerPoint PPT Presentation

Potato plastidic and nuclear DNA evolution and its relation to species evolution - ... by appropriate PCR primers, along with other Ct DNA markers ... (1988) TAG 75: 741 ... ( 1988) TAG 76: 172-176. Evolutionary Pathway of T-type Chloroplast ...

... by appropriate PCR primers, along with other Ct DNA markers ... (1988) TAG 75: 741 ... ( 1988) TAG 76: 172-176. Evolutionary Pathway of T-type Chloroplast ...

| PowerPoint PPT presentation | free to view

Slide 1 - A) B) Percentage of genes Biological process Cellular component Molecular function Percentage of genes ER plastid

A) B) Percentage of genes Biological process Cellular component Molecular function Percentage of genes ER plastid

| PowerPoint PPT presentation | free to download

Intracellular Compartments and Protein Sorting PowerPoint PPT Presentation

Intracellular Compartments and Protein Sorting - The major intracellular compartments of an animal cell ... INTRACELLULAR COMPARTMENT. An electron micrograph. Development of plastids ...

The major intracellular compartments of an animal cell ... INTRACELLULAR COMPARTMENT. An electron micrograph. Development of plastids ...

| PowerPoint PPT presentation | free to download

Are All Cells Alike PowerPoint PPT Presentation

Are All Cells Alike - Plant plastids. Chloroplast (green ... Leucoplast ('white plastid')- store starch. Chromoplast ('colored plastid')-named for pigments besides chlorophyll i.e. ...

Plant plastids. Chloroplast (green ... Leucoplast ('white plastid')- store starch. Chromoplast ('colored plastid')-named for pigments besides chlorophyll i.e. ...

| PowerPoint PPT presentation | free to view

PLANT STRUCTURE AND FUNCTION PowerPoint PPT Presentation

PLANT STRUCTURE AND FUNCTION - PLANT STRUCTURE AND FUNCTION D Jones Plant Cell Types parenchyma metabolism storage contain plastids that store store starch ...

PLANT STRUCTURE AND FUNCTION D Jones Plant Cell Types parenchyma metabolism storage contain plastids that store store starch ...

| PowerPoint PPT presentation | free to download

Organelles found in plant cells PowerPoint PPT Presentation

Organelles found in plant cells - Plastids. Plastid characteristics. Like mitochondria and nucleus with double membrane ... one of most common plastids. system of membranous stacks thylakoids ...

Plastids. Plastid characteristics. Like mitochondria and nucleus with double membrane ... one of most common plastids. system of membranous stacks thylakoids ...

| PowerPoint PPT presentation | free to view

Chloroplasts PowerPoint PPT Presentation

Chloroplasts - ... mutant with enhanced antioxidants (hp2) - shows enhanced plastid development, and - is defective in a repressors of photomorphogenesis (LsDET1) ...

... mutant with enhanced antioxidants (hp2) - shows enhanced plastid development, and - is defective in a repressors of photomorphogenesis (LsDET1) ...

| PowerPoint PPT presentation | free to download

Cell is the base of life PowerPoint PPT Presentation

Cell is the base of life - Cell is the base of life * * Plastids Thylakoids function in the steps of photosynthesis that initially convert light energy to chemical energy Collectively a stack ...

Cell is the base of life * * Plastids Thylakoids function in the steps of photosynthesis that initially convert light energy to chemical energy Collectively a stack ...

| PowerPoint PPT presentation | free to view

facebook - facebook Wall Photos Me Sources Chlory Plastid Logout Chlory Plastid is making energy from sunlight. Wall Info Photos Boxes Write something Share View photos of Chlory

facebook Wall Photos Me Sources Chlory Plastid Logout Chlory Plastid is making energy from sunlight. Wall Info Photos Boxes Write something Share View photos of Chlory

| PowerPoint PPT presentation | free to download

Presentaci - ... OASTL isoforms in A. thaliana: cytosolic OAS-A1, plastid OAS-B and mitochondrial OAS-C. The alignment was created with Vector NTI software.

... OASTL isoforms in A. thaliana: cytosolic OAS-A1, plastid OAS-B and mitochondrial OAS-C. The alignment was created with Vector NTI software.

| PowerPoint PPT presentation | free to download

THE CELL - The color of the plant is usually caused by the contents of the plastids. Chloroplasts. A chloroplast is an example of a plastid filled with chlorophyll ...

The color of the plant is usually caused by the contents of the plastids. Chloroplasts. A chloroplast is an example of a plastid filled with chlorophyll ...

| PowerPoint PPT presentation | free to view

Autophagy Central Vacuole Mitochondria Chloroplast (a PowerPoint PPT Presentation

Autophagy Central Vacuole Mitochondria Chloroplast (a - ... Autophagy Central Vacuole Mitochondria Chloroplast (a plastid) Cytoskeleton: Microtubules Organelle Movement Centrioles / Centrisomes Flagella / Cilia ...

... Autophagy Central Vacuole Mitochondria Chloroplast (a plastid) Cytoskeleton: Microtubules Organelle Movement Centrioles / Centrisomes Flagella / Cilia ...

| PowerPoint PPT presentation | free to view

Translation in Chloroplasts PowerPoint PPT Presentation

Translation in Chloroplasts - Plastid Transcriptional Regulation. Transcriptional regulation is often global or ... Stability of some plastid mRNAs increases during greening (psbA), but most ...

Plastid Transcriptional Regulation. Transcriptional regulation is often global or ... Stability of some plastid mRNAs increases during greening (psbA), but most ...

| PowerPoint PPT presentation | free to view

Bacteria and Archaea PowerPoint PPT Presentation

Bacteria and Archaea - Mitochondria. Meiosis and sex. Plastids. Shared by all eukaryotes. Only some. eukaryotes ... mitochondrion. cyanobacterium. Eukaryote. nucleus. plastid ...

Mitochondria. Meiosis and sex. Plastids. Shared by all eukaryotes. Only some. eukaryotes ... mitochondrion. cyanobacterium. Eukaryote. nucleus. plastid ...

| PowerPoint PPT presentation | free to view

Chloroplasts and Light Energy PowerPoint PPT Presentation

Chloroplasts and Light Energy - Chloroplasts Belong to the class of organelles known as the plastids. They are the sites for photosynthesis in plant cells and some forms of eukaryotic algae.

Chloroplasts Belong to the class of organelles known as the plastids. They are the sites for photosynthesis in plant cells and some forms of eukaryotic algae.

| PowerPoint PPT presentation | free to view

Fig' 16'34 - Nitrate reductase. Activity appears to be limiting in some cases (more often ... Nitrite reductase. In plastids. Uses reduced ferredoxin as the electron donor ...

Nitrate reductase. Activity appears to be limiting in some cases (more often ... Nitrite reductase. In plastids. Uses reduced ferredoxin as the electron donor ...

| PowerPoint PPT presentation | free to view

Introduction to the Cell PowerPoint PPT Presentation

Introduction to the Cell - A typical eukaryotic cell has a nucleus and membrane bound organelles. ... Chloroplast is one type of plastid, which contains green pigment chlorophyll. ...

A typical eukaryotic cell has a nucleus and membrane bound organelles. ... Chloroplast is one type of plastid, which contains green pigment chlorophyll. ...

| PowerPoint PPT presentation | free to view

Gramene database A hot spot for Comparative grass genomics PowerPoint PPT Presentation

Gramene database A hot spot for Comparative grass genomics - Organelles (plastid and mitochondrion) * Gramene Highlights. Species: Rice (Oryza) Maize (Zea) ... CMap allows genetic, physical and sequence maps to be aligned. ...

Organelles (plastid and mitochondrion) * Gramene Highlights. Species: Rice (Oryza) Maize (Zea) ... CMap allows genetic, physical and sequence maps to be aligned. ...

| PowerPoint PPT presentation | free to view

Monocots - Scattered vascular bundles (also in Nymphaeaceae, Piperaceae) Sieve cell plastids with several cuneate protein crystals (also in paleoherbs) Adventitious roots ...

Scattered vascular bundles (also in Nymphaeaceae, Piperaceae) Sieve cell plastids with several cuneate protein crystals (also in paleoherbs) Adventitious roots ...

| PowerPoint PPT presentation | free to view

PostGenomics Technologies PowerPoint PPT Presentation

PostGenomics Technologies - ARC6 Is a J-Domain Plastid Division Protein and an Evolutionary Descendant of ... SALRRIQL*AICLDFNKILLGYRIHWLCLLLHLHVIIVSNFTHFSWMLRKERELMGFCGFKL*SSQELSHWFTVA LYV ...

ARC6 Is a J-Domain Plastid Division Protein and an Evolutionary Descendant of ... SALRRIQL*AICLDFNKILLGYRIHWLCLLLHLHVIIVSNFTHFSWMLRKERELMGFCGFKL*SSQELSHWFTVA LYV ...

| PowerPoint PPT presentation | free to view

THE PROTISTS PowerPoint PPT Presentation

THE PROTISTS - Now used as an informal term Endosymbiosis Organelles were formerly prokaryotes Led to mitochondria and plastids Entered as undigested prey or parasite Mutualism ...

Now used as an informal term Endosymbiosis Organelles were formerly prokaryotes Led to mitochondria and plastids Entered as undigested prey or parasite Mutualism ...

| PowerPoint PPT presentation | free to view

Organellar Introns PowerPoint PPT Presentation

Organellar Introns - Mitochondria and plastid genomes of plants and protists (rRNA, tRNA and mRNA genes) ... Metazoan mitochondria. Not found in nuclear or viral genes ...

Mitochondria and plastid genomes of plants and protists (rRNA, tRNA and mRNA genes) ... Metazoan mitochondria. Not found in nuclear or viral genes ...

| PowerPoint PPT presentation | free to view

Diatoms - Diatoms can form small colonies, and filaments have been seen to measure over two feet. ... There is a yellow tint that can be seen due to photosynthetic plastids. ...

Diatoms can form small colonies, and filaments have been seen to measure over two feet. ... There is a yellow tint that can be seen due to photosynthetic plastids. ...

| PowerPoint PPT presentation | free to download

Cell PartsCell Organelles PowerPoint PPT Presentation

Cell PartsCell Organelles - Cells contain tiny structures that carry on specific functions ... Captures energy from the sun **Plastid seen without stain because are colored by pigments ...

Cells contain tiny structures that carry on specific functions ... Captures energy from the sun **Plastid seen without stain because are colored by pigments ...

| PowerPoint PPT presentation | free to view

Supplemental Figure 1 PowerPoint PPT Presentation

Supplemental Figure 1 - Starch and the sum of Glucose, Fructose and Sucrose are expressed as mole ... Plastid Ribosomal. Proteins. Post-translat. Modification. Supplemental Figure 7A. ...

Starch and the sum of Glucose, Fructose and Sucrose are expressed as mole ... Plastid Ribosomal. Proteins. Post-translat. Modification. Supplemental Figure 7A. ...

| PowerPoint PPT presentation | free to download

Monocistronic vs Polycistronic Genes PowerPoint PPT Presentation

Monocistronic vs Polycistronic Genes - Mitochondrial RNA Polymerase: A phage-like RNAP. Core enzyme ... They also differentiate. Chloroplasts are only the main form of a class of Organelles: Plastids ...

Mitochondrial RNA Polymerase: A phage-like RNAP. Core enzyme ... They also differentiate. Chloroplasts are only the main form of a class of Organelles: Plastids ...

| PowerPoint PPT presentation | free to view

La Cellule - Tous les tres vivants sont faits de cellules (au moins une cellule) ... wall) cellulosic. Mitochondria. of plastids and membrane (or wall) cellulosic. of ...

Tous les tres vivants sont faits de cellules (au moins une cellule) ... wall) cellulosic. Mitochondria. of plastids and membrane (or wall) cellulosic. of ...

| PowerPoint PPT presentation | free to view

Chapter 4 pgs' 6976 The history of the Cell Theory PowerPoint PPT Presentation

Chapter 4 pgs' 6976 The history of the Cell Theory - Early microscopes in 1590 when glass lenses could be polished. Robert Hooke ... Also called a Plastid. Only found in Plant Cells. Site of Photosynthesis ...

Early microscopes in 1590 when glass lenses could be polished. Robert Hooke ... Also called a Plastid. Only found in Plant Cells. Site of Photosynthesis ...

| PowerPoint PPT presentation | free to view

3a - Hypothetical evolutionary reduction of secondary plastids. to give appearance ... (cyanelles) retains aspects of the endosymbiont (unique w/euglyphid amoeba) ...

Hypothetical evolutionary reduction of secondary plastids. to give appearance ... (cyanelles) retains aspects of the endosymbiont (unique w/euglyphid amoeba) ...

| PowerPoint PPT presentation | free to view

How do light signals control nuclear genes for leaf PowerPoint PPT Presentation

How do light signals control nuclear genes for leaf - How do light signals control nuclear genes for leaf & plastid development? Can divide into 3 basic steps (or parts): Receiving the signal (photoreceptors)

How do light signals control nuclear genes for leaf & plastid development? Can divide into 3 basic steps (or parts): Receiving the signal (photoreceptors)

| PowerPoint PPT presentation | free to download

The endosymbionts transferred some of their DNA to the host genome during the evolutionary transitio PowerPoint PPT Presentation

The endosymbionts transferred some of their DNA to the host genome during the evolutionary transitio - For example, the plastids of cryptomonad algae contain ... Secondary plastid. Brown algae, diatoms, Cryptomonads, Euglena etc. The cryptomonad situation ...

For example, the plastids of cryptomonad algae contain ... Secondary plastid. Brown algae, diatoms, Cryptomonads, Euglena etc. The cryptomonad situation ...

| PowerPoint PPT presentation | free to view

Translation in Chloroplasts - Scanning ? Some of the proteins that bind the 5' UTRs of mRNAs promote translation ... expressed poorly if plastids don't develop, or are damaged by photo-oxidation. ...

Scanning ? Some of the proteins that bind the 5' UTRs of mRNAs promote translation ... expressed poorly if plastids don't develop, or are damaged by photo-oxidation. ...

| PowerPoint PPT presentation | free to view

There are computer programs that will predict the topology and posttranslational modification of you PowerPoint PPT Presentation

There are computer programs that will predict the topology and posttranslational modification of you - Use the computer programs described on the next few s to predict the ... Predotar - Prediction of mitochondrial and plastid targeting sequences ...

Use the computer programs described on the next few s to predict the ... Predotar - Prediction of mitochondrial and plastid targeting sequences ...

| PowerPoint PPT presentation | free to view

Some mt - Some mt & cp proteins contain subunits encoded by organelle s genome

Some mt & cp proteins contain subunits encoded by organelle s genome

| PowerPoint PPT presentation | free to download

Chloroplast genome: Evolution, structure and regulation of the gene expression PowerPoint PPT Presentation

Chloroplast genome: Evolution, structure and regulation of the gene expression - Chloroplast genome: Evolution, structure and regulation of the gene expression Darin I. Peshev Chloroplasts Chloroplasts Development of chloroplasts Development of ...

Chloroplast genome: Evolution, structure and regulation of the gene expression Darin I. Peshev Chloroplasts Chloroplasts Development of chloroplasts Development of ...

| PowerPoint PPT presentation | free to view

Chloroplast Genome Evolution PowerPoint PPT Presentation

Chloroplast Genome Evolution - Carries out photosynthesis. Contains own genome. Believed to be of endosymbiotic origin ... Photosynthesis. Metabolism. The inverted repeat (IR) Ranges from 5bk ...

Carries out photosynthesis. Contains own genome. Believed to be of endosymbiotic origin ... Photosynthesis. Metabolism. The inverted repeat (IR) Ranges from 5bk ...

| PowerPoint PPT presentation | free to download

Assembly, Transport PowerPoint PPT Presentation

Assembly, Transport - Assembly, Transport & Storage Other organelles F. Endoplasmic Reticulum Structure = Rough ER Covered in ribosomes Smooth ER No ribosomes Function = Where chemical ...

Assembly, Transport & Storage Other organelles F. Endoplasmic Reticulum Structure = Rough ER Covered in ribosomes Smooth ER No ribosomes Function = Where chemical ...

| PowerPoint PPT presentation | free to view

Some mt - Some mt & cp proteins contain subunits encoded by organelle s genome Cytoplasmic inheritance first seen as strictly maternally inherited albino variegation no ...

Some mt & cp proteins contain subunits encoded by organelle s genome Cytoplasmic inheritance first seen as strictly maternally inherited albino variegation no ...

| PowerPoint PPT presentation | free to download

Microbial Diversity PowerPoint PPT Presentation

Microbial Diversity - Title: Prokaryotes and Metabolic Diversity Author: Jay Comeaux Last modified by: Kyle Harms Created Date: 2/24/2003 1:26:59 PM Document presentation format

Title: Prokaryotes and Metabolic Diversity Author: Jay Comeaux Last modified by: Kyle Harms Created Date: 2/24/2003 1:26:59 PM Document presentation format

| PowerPoint PPT presentation | free to view

Monocistronic vs Polycistronic Genes - Isolated Spinach chloroplast envelope thylakoid membrane stroma From Hoober Chloroplast RNA polymerases (RNAPs) Two different RNAPs in vascular plant chloroplasts ...

Isolated Spinach chloroplast envelope thylakoid membrane stroma From Hoober Chloroplast RNA polymerases (RNAPs) Two different RNAPs in vascular plant chloroplasts ...

| PowerPoint PPT presentation | free to download

Chapter 4 : Cells PowerPoint PPT Presentation

Chapter 4 : Cells - Chapter 4 : Cells Cell Discovery 1. Robert Hooke 1664 saw 1st cell and named it a cell. 2. Schleiden, Schwann, and Virchow - made up cell theory.

Chapter 4 : Cells Cell Discovery 1. Robert Hooke 1664 saw 1st cell and named it a cell. 2. Schleiden, Schwann, and Virchow - made up cell theory.

| PowerPoint PPT presentation | free to download

THE PROTISTS - THE PROTISTS The dilemma Systematists have split protists into many kingdoms. Originally grouped as mostly unicellular eukaryotes Problem: Paraphyletic grouping ...

THE PROTISTS The dilemma Systematists have split protists into many kingdoms. Originally grouped as mostly unicellular eukaryotes Problem: Paraphyletic grouping ...

| PowerPoint PPT presentation | free to view

How do light signals control nuclear genes for leaf - Title: Dr Joanne Chory of The Salk Institute, Howard Hughes Medical Institute will be presenting a seminar on

Title: Dr Joanne Chory of The Salk Institute, Howard Hughes Medical Institute will be presenting a seminar on

| PowerPoint PPT presentation | free to download

NONMEMBRANE BOUND ORGANELLES PowerPoint PPT Presentation

NONMEMBRANE BOUND ORGANELLES - Space - MIDDLE LAMELLA - filled by PECTINS. Communication ... Middle lamella. Animals: Gap junctions. heart muscle cells example. Animals: Adhesion of cells: ...

Space - MIDDLE LAMELLA - filled by PECTINS. Communication ... Middle lamella. Animals: Gap junctions. heart muscle cells example. Animals: Adhesion of cells: ...

| PowerPoint PPT presentation | free to view

BS 101 PLANT CELLS PowerPoint PPT Presentation

BS 101 PLANT CELLS - ... Cell Growth and Development - apical meristems, cell division, expansion and differentiation. ... to in vitro procedures and applications; secondary ...

... Cell Growth and Development - apical meristems, cell division, expansion and differentiation. ... to in vitro procedures and applications; secondary ...

| PowerPoint PPT presentation | free to view

VII. Cell Parts PowerPoint PPT Presentation

VII. Cell Parts - VII. Cell Parts Dissecting the cell Quick Definitions Homeostasis is the process of maintaining the cell s environment. Selective permeability is the process where ...

VII. Cell Parts Dissecting the cell Quick Definitions Homeostasis is the process of maintaining the cell s environment. Selective permeability is the process where ...

| PowerPoint PPT presentation | free to view

RESPIRATION - Structure of plant mitochondria. Bean. 10. BIOL. 350 Spring 08 ... Plant mitochondria contain additional enzymes (in green), which do not pump protons. ...

Structure of plant mitochondria. Bean. 10. BIOL. 350 Spring 08 ... Plant mitochondria contain additional enzymes (in green), which do not pump protons. ...

| PowerPoint PPT presentation | free to view

Protist diversity I PowerPoint PPT Presentation

Protist diversity I - Protist diversity I Level 1 Biological Diversity Jim Provan Diversity of protists In Whittaker s five-kingdom system, eukaryotes were divided into four of the five ...

Protist diversity I Level 1 Biological Diversity Jim Provan Diversity of protists In Whittaker s five-kingdom system, eukaryotes were divided into four of the five ...

| PowerPoint PPT presentation | free to view

Plastid PowerPoint PPT Presentations