967 Superfamilies PPTs View free & download

1' Receptor superfamilies PowerPoint PPT Presentation

1' Receptor superfamilies - Ion channel receptors (Ligand gated ion channels) Five glycoprotein subunits. traversing cell membrane. Messenger. Receptor. INDUCED. FIT. GATING' (ion channel. opens) ...

Ion channel receptors (Ligand gated ion channels) Five glycoprotein subunits. traversing cell membrane. Messenger. Receptor. INDUCED. FIT. GATING' (ion channel. opens) ...

| PowerPoint PPT presentation | free to view

Superfamilies: Orbitodacea, Spirillinacea, Duostominacea and Robertinacea PowerPoint PPT Presentation

Superfamilies: Orbitodacea, Spirillinacea, Duostominacea and Robertinacea - The orbitoids are a Late Cretaceous to Miocene group of 'larger foraminifera' ... Patellina has a trochospiral to biserial test in which the chambers are ...

The orbitoids are a Late Cretaceous to Miocene group of 'larger foraminifera' ... Patellina has a trochospiral to biserial test in which the chambers are ...

| PowerPoint PPT presentation | free to view

HYMENOPTERA - HYMENOPTERA (wasps, bees, ants) * * * * * * * * * * * * * * * * Hymenoptera - Classification Superfamilies 3) Vespoidea - wasps, hornets, yellowjackets Yellowjacket ...

HYMENOPTERA (wasps, bees, ants) * * * * * * * * * * * * * * * * Hymenoptera - Classification Superfamilies 3) Vespoidea - wasps, hornets, yellowjackets Yellowjacket ...

| PowerPoint PPT presentation | free to view

Protein Homology Detection Using String Alignment Kernels PowerPoint PPT Presentation

Protein Homology Detection Using String Alignment Kernels - Problem: classification of protein sequence data into families and superfamilies ... SCOP: Structural Classification of Proteins ...

Problem: classification of protein sequence data into families and superfamilies ... SCOP: Structural Classification of Proteins ...

| PowerPoint PPT presentation | free to view

HYMENOPTERA - waist - includes most Hymenoptera. Aculeata (stinging forms) ... Hymenoptera - Classification. Superfamilies. 4) Sphecoidea - digger wasps, mud daubers, potters ...

waist - includes most Hymenoptera. Aculeata (stinging forms) ... Hymenoptera - Classification. Superfamilies. 4) Sphecoidea - digger wasps, mud daubers, potters ...

| PowerPoint PPT presentation | free to view

MACHINE LEARNING TECHNIQUES APPLIED TO PROTEIN FOLD AND REMOTE HOMOLOGUE RECOGNITION PowerPoint PPT Presentation

MACHINE LEARNING TECHNIQUES APPLIED TO PROTEIN FOLD AND REMOTE HOMOLOGUE RECOGNITION - Goal - correct SCOP fold/superfamily prediction ... Currently increasing coverage of SCOP superfamilies and optimising existing ...

Goal - correct SCOP fold/superfamily prediction ... Currently increasing coverage of SCOP superfamilies and optimising existing ...

| PowerPoint PPT presentation | free to view

Multidrug Efflux from Bacteria PowerPoint PPT Presentation

Multidrug Efflux from Bacteria - ABC-ATPases constitute one of the largest and most highly conserved protein superfamilies ... Similarly, ABC-transporters provide multi-drug resistance in bacteria ...

ABC-ATPases constitute one of the largest and most highly conserved protein superfamilies ... Similarly, ABC-transporters provide multi-drug resistance in bacteria ...

| PowerPoint PPT presentation | free to view

Sn - Genetic information is transferred into proteins ... SCOP (Structural Classification of Proteins) with 1200 protein superfamilies ...

Genetic information is transferred into proteins ... SCOP (Structural Classification of Proteins) with 1200 protein superfamilies ...

| PowerPoint PPT presentation | free to download

Ion Selection: Cationic Channels PowerPoint PPT Presentation

Ion Selection: Cationic Channels - Superfamilies of Ligand-gated Ion Channels. 1. Cys-loop Receptors. Nicotinic ... Modified from Zigmond et al. (Eds.) Fundamental Neuroscience, Sinauer (1999) ...

Superfamilies of Ligand-gated Ion Channels. 1. Cys-loop Receptors. Nicotinic ... Modified from Zigmond et al. (Eds.) Fundamental Neuroscience, Sinauer (1999) ...

| PowerPoint PPT presentation | free to view

26S Proteasome and Protein Stability PowerPoint PPT Presentation

26S Proteasome and Protein Stability - CATH and SCOP are two of these, each containing 950-1400 protein superfamilies ... SCOP database. Classification scheme: Class, ... HMM's also useful at SCOP ...

CATH and SCOP are two of these, each containing 950-1400 protein superfamilies ... SCOP database. Classification scheme: Class, ... HMM's also useful at SCOP ...

| PowerPoint PPT presentation | free to view

Are Butterflies and Moths Monophyletic Introduction to Phylogenetic Analysis Project PowerPoint PPT Presentation

Are Butterflies and Moths Monophyletic Introduction to Phylogenetic Analysis Project - 180,000 Species, 128 Families, 47 Superfamilies. Lepis 'scale', ptera 'wing' Scale wing ... Molecular data: ND1 gene (mitochondrial) and 18S & 28S rRNA (HENNIG86) ...

180,000 Species, 128 Families, 47 Superfamilies. Lepis 'scale', ptera 'wing' Scale wing ... Molecular data: ND1 gene (mitochondrial) and 18S & 28S rRNA (HENNIG86) ...

| PowerPoint PPT presentation | free to view

PROTEIN DATABASES - protein databases

protein databases

| PowerPoint PPT presentation | free to download

BLOCKS - BLOCKS http://www.blocks.fhcrc.org/ Multiply aligned ungapped segments corresponding to most highly conserved regions of proteins- represented in profile

BLOCKS http://www.blocks.fhcrc.org/ Multiply aligned ungapped segments corresponding to most highly conserved regions of proteins- represented in profile

| PowerPoint PPT presentation | free to download

How close are we to having seen all folds PowerPoint PPT Presentation

How close are we to having seen all folds - How close are we to having seen all folds. OR is ab initio structure prediction about ... Heger, Holm (2003) JMB 328: 749. COG. Tatusov et al. (2000) NAR 28: 33 ...

How close are we to having seen all folds. OR is ab initio structure prediction about ... Heger, Holm (2003) JMB 328: 749. COG. Tatusov et al. (2000) NAR 28: 33 ...

| PowerPoint PPT presentation | free to download

PROTEIN PATTERN DATABASES - protein pattern databases

protein pattern databases

| PowerPoint PPT presentation | free to download

October 10, 2003 PowerPoint PPT Presentation

October 10, 2003 - http://pir.georgetown.edu/pirwww/search/pirnref.shtml ... Other Molecular Databases ... 47. Composition & Molecular Weight Calculation. 48. PIR support center ...

http://pir.georgetown.edu/pirwww/search/pirnref.shtml ... Other Molecular Databases ... 47. Composition & Molecular Weight Calculation. 48. PIR support center ...

| PowerPoint PPT presentation | free to download

PROTEIN DATABASES - All the information items must be retrievable by computer programs in a consistent manner ... Includes data from NCBI Human Genome Annotation Project. SWISS-PROT ...

All the information items must be retrievable by computer programs in a consistent manner ... Includes data from NCBI Human Genome Annotation Project. SWISS-PROT ...

| PowerPoint PPT presentation | free to download

Types of microfossils shell composition SiO2 Diatoms 1 celled algae 3100 size freshwater and marine PowerPoint PPT Presentation

Types of microfossils shell composition SiO2 Diatoms 1 celled algae 3100 size freshwater and marine - 4 56789: ... P ''a GpSs tFTOdfe n ...

4 56789: ... P ''a GpSs tFTOdfe n ...

| PowerPoint PPT presentation | free to view

Voltage-Gated Ion Channels and the Action Potential PowerPoint PPT Presentation

Voltage-Gated Ion Channels and the Action Potential - Vm = the Value of the Na Battery Plus the. Voltage Drop Across gNa. Im. VC. Calculation of gNa ... Vm = ENa INa/gNa. INa = gNa (Vm - ENa) gNa = INa/(Vm - ENa) ...

Vm = the Value of the Na Battery Plus the. Voltage Drop Across gNa. Im. VC. Calculation of gNa ... Vm = ENa INa/gNa. INa = gNa (Vm - ENa) gNa = INa/(Vm - ENa) ...

| PowerPoint PPT presentation | free to download

Statistical Evaluation of Pairwise Protein Sequence Comparison with the Bayesian Bootstrap - Statistical Evaluation of Pairwise Protein Sequence Comparison with the Bayesian Bootstrap

Statistical Evaluation of Pairwise Protein Sequence Comparison with the Bayesian Bootstrap

| PowerPoint PPT presentation | free to view

NURO 346 Robert L. Macdonald, M.D., Ph.D. Structure and Function of LigandGated Ion Channels LGICs J - NURO 346 Robert L. Macdonald, M.D., Ph.D. Structure and Function of LigandGated Ion Channels LGICs J

NURO 346 Robert L. Macdonald, M.D., Ph.D. Structure and Function of LigandGated Ion Channels LGICs J

| PowerPoint PPT presentation | free to view

Pumps and Carriers PowerPoint PPT Presentation

Pumps and Carriers - Experiments in Glucose Transport. Structure and Mechanism. The Na ... Poise. Substrate(s) Subunits. Structure. Example. Superfamily. Chemiosmotic Circuits ...

Experiments in Glucose Transport. Structure and Mechanism. The Na ... Poise. Substrate(s) Subunits. Structure. Example. Superfamily. Chemiosmotic Circuits ...

| PowerPoint PPT presentation | free to view

Morphology and ontology efforts by the Lepidoptera AToL PowerPoint PPT Presentation

Morphology and ontology efforts by the Lepidoptera AToL - Morphology and ontology efforts by the Lepidoptera AToL. Cynthia Parr. University of Maryland ... Lepidopterist community describes systematics and life history ...

Morphology and ontology efforts by the Lepidoptera AToL. Cynthia Parr. University of Maryland ... Lepidopterist community describes systematics and life history ...

| PowerPoint PPT presentation | free to view

Introduction to Bioinformatics PowerPoint PPT Presentation

Introduction to Bioinformatics - Title: PowerPoint Presentation Author: Robert A. Scott Last modified by: heringa Created Date: 4/8/2002 2:53:29 AM Document presentation format: On-screen Show

Title: PowerPoint Presentation Author: Robert A. Scott Last modified by: heringa Created Date: 4/8/2002 2:53:29 AM Document presentation format: On-screen Show

| PowerPoint PPT presentation | free to download

PROTEIN PATTERN DATABASES - ... models), can use two modes ls or fs, all domains should be matched with ls ... expressions, profiles, fingerprints, Hidden Markov Models and ProDom domains ...

... models), can use two modes ls or fs, all domains should be matched with ls ... expressions, profiles, fingerprints, Hidden Markov Models and ProDom domains ...

| PowerPoint PPT presentation | free to download

Biophysics%20101:%20Genomics%20 PowerPoint PPT Presentation

Biophysics%20101:%20Genomics%20 - van der Waals radii on, also colored CPK. Based on the backbone and H-bond configuration shown, ... bombard with X-rays, record scattering diffraction patterns ...

van der Waals radii on, also colored CPK. Based on the backbone and H-bond configuration shown, ... bombard with X-rays, record scattering diffraction patterns ...

| PowerPoint PPT presentation | free to download

Conservation of Orientation and Sequence in Protein DomainDomain Interactions Stephen J. Littler and PowerPoint PPT Presentation

Conservation of Orientation and Sequence in Protein DomainDomain Interactions Stephen J. Littler and - Interactions considered in pairwise fashion within single polypepetide chain. ... interaction with respect to surface sites and binding angle was investigated. ...

Interactions considered in pairwise fashion within single polypepetide chain. ... interaction with respect to surface sites and binding angle was investigated. ...

| PowerPoint PPT presentation | free to view

Lupyan D, LeoMacias A, Ortiz AR' PowerPoint PPT Presentation

Lupyan D, LeoMacias A, Ortiz AR' - MAMMOTH = MAtching Molecular Models Obtained from THeory- pairwise structure ... CE has 8, Dali has 5, MAMMOTH 7 ! ... all pairwise comparison with MAMMOTH. ...

MAMMOTH = MAtching Molecular Models Obtained from THeory- pairwise structure ... CE has 8, Dali has 5, MAMMOTH 7 ! ... all pairwise comparison with MAMMOTH. ...

| PowerPoint PPT presentation | free to view

Dr' Lloyd Old PowerPoint PPT Presentation

Dr' Lloyd Old - According to the type of the receptor/intracellular signal ... ? ??????? ???????? ??????? (???????: gld, lpr, tabby, downless, crinkled) ...

According to the type of the receptor/intracellular signal ... ? ??????? ???????? ??????? (???????: gld, lpr, tabby, downless, crinkled) ...

| PowerPoint PPT presentation | free to view

Pairwise sequence PowerPoint PPT Presentation

Pairwise sequence - Pairwise sequence Alignment Homology, Score Matrix

Pairwise sequence Alignment Homology, Score Matrix

| PowerPoint PPT presentation | free to download

Protein Structural Prediction - Protein Structural Prediction

Protein Structural Prediction

| PowerPoint PPT presentation | free to download

Introduction to Bioinformatics - C E N T R F O R I N T E G R A T I V E E B I O I N F O R M A T I C S V U Introduction to Bioinformatics Lecture 15: Predicting Protein Function Centre for Integrative ...

C E N T R F O R I N T E G R A T I V E E B I O I N F O R M A T I C S V U Introduction to Bioinformatics Lecture 15: Predicting Protein Function Centre for Integrative ...

| PowerPoint PPT presentation | free to download

Chapter 8Proteomics PowerPoint PPT Presentation

Chapter 8Proteomics - Chapter 8 Proteomics 2004/06/07

Chapter 8 Proteomics 2004/06/07

| PowerPoint PPT presentation | free to download

Bioinformatics master course DNA/Protein structure-function analysis and prediction Lecture 5: Protein Fold Families PowerPoint PPT Presentation

Bioinformatics master course DNA/Protein structure-function analysis and prediction Lecture 5: Protein Fold Families - Title: PowerPoint Presentation Author: heringa Last modified by: heringa Created Date: 2/3/2003 6:56:45 PM Document presentation format: On-screen Show

Title: PowerPoint Presentation Author: heringa Last modified by: heringa Created Date: 2/3/2003 6:56:45 PM Document presentation format: On-screen Show

| PowerPoint PPT presentation | free to view

Introduction to Databases PowerPoint PPT Presentation

Introduction to Databases - we interacted directly and manually with databases and tools ... PubDate Year 1999 /Year Month Nov /Month /PubDate /JournalIssue /Journal ...

we interacted directly and manually with databases and tools ... PubDate Year 1999 /Year Month Nov /Month /PubDate /JournalIssue /Journal ...

| PowerPoint PPT presentation | free to view

SCOP DATABASE PowerPoint PPT Presentation

SCOP DATABASE - SCOP DATABASE. SCOP STATISTICS. Classification. Proteins are classified to reflect both structural ... SCOP STATISTICS. Class of number of Number of Number of ...

SCOP DATABASE. SCOP STATISTICS. Classification. Proteins are classified to reflect both structural ... SCOP STATISTICS. Class of number of Number of Number of ...

| PowerPoint PPT presentation | free to view

Protein Classification PowerPoint PPT Presentation

Protein Classification - Protein Classification PDB Growth Protein classification Number of protein sequences grow exponentially Number of solved structures grow exponentially Number of new ...

Protein Classification PDB Growth Protein classification Number of protein sequences grow exponentially Number of solved structures grow exponentially Number of new ...

| PowerPoint PPT presentation | free to download

LSM2104/CZ2251 PowerPoint PPT Presentation

LSM2104/CZ2251 - Protein Structure and Visualization (2) Chen Yu Zong csccyz@nus.edu.sg 6874-6877 LSM2104/CZ2251 Essential Bioinformatics and Biocomputing Only deposited data is ...

Protein Structure and Visualization (2) Chen Yu Zong csccyz@nus.edu.sg 6874-6877 LSM2104/CZ2251 Essential Bioinformatics and Biocomputing Only deposited data is ...

| PowerPoint PPT presentation | free to download

Evolution at the Molecular Level PowerPoint PPT Presentation

Evolution at the Molecular Level - Evolution at the Molecular Level Outline Evolution of genomes Review of various types and effects of mutations How larger genomes evolve through duplication and ...

Evolution at the Molecular Level Outline Evolution of genomes Review of various types and effects of mutations How larger genomes evolve through duplication and ...

| PowerPoint PPT presentation | free to view

Bioinformatics and Proteomics PowerPoint PPT Presentation

Bioinformatics and Proteomics - Myo (Cod) HbA (Cod) HbB (Cod) Myo (Frog) HbA (Frog) HbB (Frog) Myo (Rat) ... LCA of Vertebrata. Orthologs and Paralogs. Myo (Cod) HbA (Cod) HbB (Cod) Myo (Frog) ...

Myo (Cod) HbA (Cod) HbB (Cod) Myo (Frog) HbA (Frog) HbB (Frog) Myo (Rat) ... LCA of Vertebrata. Orthologs and Paralogs. Myo (Cod) HbA (Cod) HbB (Cod) Myo (Frog) ...

| PowerPoint PPT presentation | free to download

Support Vector Machine and String Kernels for Protein Classification PowerPoint PPT Presentation

Support Vector Machine and String Kernels for Protein Classification - 1A3N:A HEMOGLOBIN. VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK ... 1A3N:B HEMOGLOBIN. VHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKV ...

1A3N:A HEMOGLOBIN. VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK ... 1A3N:B HEMOGLOBIN. VHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKV ...

| PowerPoint PPT presentation | free to download

Protein Classification - Detect similarities (evolutionary relationships) between protein sequences ... www.biochem.ucl.ac.uk/bsm/cath. FSSP. Automatic classification (L. Holm) ...

Detect similarities (evolutionary relationships) between protein sequences ... www.biochem.ucl.ac.uk/bsm/cath. FSSP. Automatic classification (L. Holm) ...

| PowerPoint PPT presentation | free to download

Introduction to Bioinformatics - Introduction to Bioinformatics Lecture 13: Predicting Protein Function Centre for Integrative Bioinformatics VU (IBIVU) Outline Sequence-based function prediction ...

Introduction to Bioinformatics Lecture 13: Predicting Protein Function Centre for Integrative Bioinformatics VU (IBIVU) Outline Sequence-based function prediction ...

| PowerPoint PPT presentation | free to download

Network Properties PowerPoint PPT Presentation

Network Properties - Network Properties Global Network Properties (Chapter 3 of the course textbook Analysis of Biological Networks by Junker and Schreiber) Degree distribution

Network Properties Global Network Properties (Chapter 3 of the course textbook Analysis of Biological Networks by Junker and Schreiber) Degree distribution

| PowerPoint PPT presentation | free to download

Structure Databases PowerPoint PPT Presentation

Structure Databases - a usually large collection of data organized especially for rapid search and ... IPI, GOA, GO, Proteome Analysis, HPI, IntEnz, TrEMBLnew, SP_ML, NEWT, PANDIT ...

a usually large collection of data organized especially for rapid search and ... IPI, GOA, GO, Proteome Analysis, HPI, IntEnz, TrEMBLnew, SP_ML, NEWT, PANDIT ...

| PowerPoint PPT presentation | free to view

Network topology and evolution of hard to gain and hard to loose attributes PowerPoint PPT Presentation

Network topology and evolution of hard to gain and hard to loose attributes - Network topology and evolution of hard to gain and hard to loose attributes ... Lab members. Raja Jothi. Elena Zotenko. And NCBI journal club discussion group ...

Network topology and evolution of hard to gain and hard to loose attributes ... Lab members. Raja Jothi. Elena Zotenko. And NCBI journal club discussion group ...

| PowerPoint PPT presentation | free to download

Markov chains PowerPoint PPT Presentation

Markov chains - From Markov Chains to Hidden Markov Models (HMM) ... Hidden Markov Model. for protein sequences. three types ... E.g. SCOP http://scop.mrc-lmb.cam.ac.uk/scop ...

From Markov Chains to Hidden Markov Models (HMM) ... Hidden Markov Model. for protein sequences. three types ... E.g. SCOP http://scop.mrc-lmb.cam.ac.uk/scop ...

| PowerPoint PPT presentation | free to view

Primate and Human Evolution main points PowerPoint PPT Presentation

Primate and Human Evolution main points - Primate and Human Evolution main points . 1. primates demonstrate a great deal of variation and increasing complexity through time. 2. hominids include present day ...

Primate and Human Evolution main points . 1. primates demonstrate a great deal of variation and increasing complexity through time. 2. hominids include present day ...

| PowerPoint PPT presentation | free to view

Bio-Trac 25 (Proteomics: Principles and Methods) PowerPoint PPT Presentation

Bio-Trac 25 (Proteomics: Principles and Methods) - Molecular Biology Database Collection (http://nar.oupjournals.org/cgi/content ... WIT: Functional Curation and Metabolic Models. BRENDA: Enzyme Database ...

Molecular Biology Database Collection (http://nar.oupjournals.org/cgi/content ... WIT: Functional Curation and Metabolic Models. BRENDA: Enzyme Database ...

| PowerPoint PPT presentation | free to view

Morphology and ontology efforts by the Lepidoptera AToL - Jamboree: Given tree and collaborative human examination of evidence? ... Enter references for shared references bank, Taxon Pages and TOL pages ...

Jamboree: Given tree and collaborative human examination of evidence? ... Enter references for shared references bank, Taxon Pages and TOL pages ...

| PowerPoint PPT presentation | free to view

Pairwise alignment incorporating PowerPoint PPT Presentation

Pairwise alignment incorporating - ... is derived from the structural classification of proteins (SCOP) database. We partition SCOP data into separate test and training subsets of approximately ...

... is derived from the structural classification of proteins (SCOP) database. We partition SCOP data into separate test and training subsets of approximately ...

| PowerPoint PPT presentation | free to download

Protein-protein interactions PowerPoint PPT Presentation

Protein-protein interactions - Does not rely on DIRECT SEQUENCE HOMOLOGY ... 2 proteins are neighbors on the chromosome, the proteins tend to be functionally ...

Does not rely on DIRECT SEQUENCE HOMOLOGY ... 2 proteins are neighbors on the chromosome, the proteins tend to be functionally ...

| PowerPoint PPT presentation | free to download

Introduction to GeneDoc PowerPoint PPT Presentation

Introduction to GeneDoc - ... of the shading modes are actually visual displays of widely used analyses of ... The property shading mode allows the user to divide the possible sequence ...

... of the shading modes are actually visual displays of widely used analyses of ... The property shading mode allows the user to divide the possible sequence ...

| PowerPoint PPT presentation | free to view

Efflux pumps in hepatocytes: PowerPoint PPT Presentation

Efflux pumps in hepatocytes: - The hydrophobicity of various peptides of the transporter can be tested with Trp ... Example for the hydrophobicity test with Trp as a fluorescent probe. ...

The hydrophobicity of various peptides of the transporter can be tested with Trp ... Example for the hydrophobicity test with Trp as a fluorescent probe. ...

| PowerPoint PPT presentation | free to view

Support Vector Machine and String Kernels for Protein Classification - Support Vector Machine and String Kernels for Protein Classification Christina Leslie Department of Computer Science Columbia University Learning Sequence-based ...

Support Vector Machine and String Kernels for Protein Classification Christina Leslie Department of Computer Science Columbia University Learning Sequence-based ...

| PowerPoint PPT presentation | free to download

Anastasia Nikolskaya PowerPoint PPT Presentation

Anastasia Nikolskaya - Evolution by recent duplication and loss. Origin traceable to a single gene in LCA ... Creation and curation of PIRSFs. UniProt proteins. Preliminary ...

Evolution by recent duplication and loss. Origin traceable to a single gene in LCA ... Creation and curation of PIRSFs. UniProt proteins. Preliminary ...

| PowerPoint PPT presentation | free to view

Superfamilies PowerPoint PPT Presentations