Postgenomic PowerPoint PPT Presentations

All Time
Show:
Recommended
Sort by:
PostGenomics Technologies PowerPoint PPT Presentation
PostGenomics Technologies - ARC6 Is a J-Domain Plastid Division Protein and an Evolutionary Descendant of ... SALRRIQL*AICLDFNKILLGYRIHWLCLLLHLHVIIVSNFTHFSWMLRKERELMGFCGFKL*SSQELSHWFTVA LYV ...
ARC6 Is a J-Domain Plastid Division Protein and an Evolutionary Descendant of ... SALRRIQL*AICLDFNKILLGYRIHWLCLLLHLHVIIVSNFTHFSWMLRKERELMGFCGFKL*SSQELSHWFTVA LYV ...
| PowerPoint PPT presentation | free to view
Postgenomic Era PowerPoint PPT Presentation
Postgenomic Era - Molecular Function. What does the protein do? ... Molecular Function ... Molecular structure of proteins = amino acid chain. Amino acid ...
Molecular Function. What does the protein do? ... Molecular Function ... Molecular structure of proteins = amino acid chain. Amino acid ...
| PowerPoint PPT presentation | free to view
Metabolomics: an emerging field in the postgenomic era PowerPoint PPT Presentation
Metabolomics: an emerging field in the postgenomic era - 1. Metabolomics: an emerging field in the post-genomic era. Ming-Shi Shiao ... OMICS' in the post-genomic era. 1. Genomics and epigenomics. 2. ... A. Biogenesis ...
1. Metabolomics: an emerging field in the post-genomic era. Ming-Shi Shiao ... OMICS' in the post-genomic era. 1. Genomics and epigenomics. 2. ... A. Biogenesis ...
| PowerPoint PPT presentation | free to view
Echobase: keeping pace with Escherichia coli in the postgenomic era' PowerPoint PPT Presentation
Echobase: keeping pace with Escherichia coli in the postgenomic era' - Isolated in 1886 by Theodor von Escherich, from the intestines of children. Normal ... Echobase is a boutique' database for the E. coli research community. ...
Isolated in 1886 by Theodor von Escherich, from the intestines of children. Normal ... Echobase is a boutique' database for the E. coli research community. ...
| PowerPoint PPT presentation | free to download
NMR in the postgenomic era: a holistic approach to the study of biological systems PowerPoint PPT Presentation
NMR in the postgenomic era: a holistic approach to the study of biological systems - ... metabolite synthesis (cataplerosis): gluconeogenesis and acetate production via citrate shuttle. ... through the TCA cycle towards gluconeogenesis. ...
... metabolite synthesis (cataplerosis): gluconeogenesis and acetate production via citrate shuttle. ... through the TCA cycle towards gluconeogenesis. ...
| PowerPoint PPT presentation | free to view
From genes to patient care: delivering clinical services in the postgenomic era PowerPoint PPT Presentation
From genes to patient care: delivering clinical services in the postgenomic era - Customising care to reflect individual genetic profiles. ... (IRIDIUM) Dialogue. Manager (HOMEY) Clinical. Process. modelling. BrCa pathway. Guideline ...
Customising care to reflect individual genetic profiles. ... (IRIDIUM) Dialogue. Manager (HOMEY) Clinical. Process. modelling. BrCa pathway. Guideline ...
| PowerPoint PPT presentation | free to view
Introduction to Bioinformatics: Lecture I An Overview of the Course PowerPoint PPT Presentation
Introduction to Bioinformatics: Lecture I An Overview of the Course - Division of Biomedical Informatics, Children's Hospital Research Foundation ... Bioinformatics as hypothesis generator for biomedical research in the postgenomic era ...
Division of Biomedical Informatics, Children's Hospital Research Foundation ... Bioinformatics as hypothesis generator for biomedical research in the postgenomic era ...
| PowerPoint PPT presentation | free to view
Genetic association studies of complex diseases PowerPoint PPT Presentation
Genetic association studies of complex diseases - Aggregate in families but do not segregate in mendelian fashion. Multigenic ... et al. GENOMICS AND MEDICINE: Dissecting Human Disease in the Postgenomic Era. ...
Aggregate in families but do not segregate in mendelian fashion. Multigenic ... et al. GENOMICS AND MEDICINE: Dissecting Human Disease in the Postgenomic Era. ...
| PowerPoint PPT presentation | free to view
Download ⚡️ The Maternal Imprint: The Contested Science of Maternal-Fetal Effects PowerPoint PPT Presentation
Download ⚡️ The Maternal Imprint: The Contested Science of Maternal-Fetal Effects - Copy Link ; good.readbooks.link/pwr/022654480X
Copy Link ; good.readbooks.link/pwr/022654480X
| PowerPoint PPT presentation | free to download
BIOPOLITICS, ETHICS AND REGENERATIVE MEDICINE PowerPoint PPT Presentation
BIOPOLITICS, ETHICS AND REGENERATIVE MEDICINE - CENTRO DE ESTUDOS SOCIAIS LABORAT RIO ASSOCIADO ... National legislation. Bioethics committees. Public engagement initiatives. Collective action ...
CENTRO DE ESTUDOS SOCIAIS LABORAT RIO ASSOCIADO ... National legislation. Bioethics committees. Public engagement initiatives. Collective action ...
| PowerPoint PPT presentation | free to view
PathoGenomics in France The Genopole network PowerPoint PPT Presentation
PathoGenomics in France The Genopole network - Limited national funding for projects ... The CRNG (National Comity for Genomic Research) involves the CNRS, INRA, INSERM and CEA ...
Limited national funding for projects ... The CRNG (National Comity for Genomic Research) involves the CNRS, INRA, INSERM and CEA ...
| PowerPoint PPT presentation | free to view
Proteomics%20in%20Analysis%20of%20Bacterial%20Pathogens PowerPoint PPT Presentation
Proteomics%20in%20Analysis%20of%20Bacterial%20Pathogens - Title: PowerPoint Presentation Author: TVINA Last modified by: Tina Guina Created Date: 5/13/2003 7:16:49 AM Document presentation format: On-screen Show
Title: PowerPoint Presentation Author: TVINA Last modified by: Tina Guina Created Date: 5/13/2003 7:16:49 AM Document presentation format: On-screen Show
| PowerPoint PPT presentation | free to download
Proteomics in Analysis of Bacterial Pathogens PowerPoint PPT Presentation
Proteomics in Analysis of Bacterial Pathogens - Cystic fibrosis (CF): most common genetic disease in Caucasians ... and Cystic Fibrosis. Environmental P. ... Infection in Cystic Fibrosis. Intervention ...
Cystic fibrosis (CF): most common genetic disease in Caucasians ... and Cystic Fibrosis. Environmental P. ... Infection in Cystic Fibrosis. Intervention ...
| PowerPoint PPT presentation | free to view
Trends in Bioinformatics PowerPoint PPT Presentation
Trends in Bioinformatics - University of Madras. Outline of Presentation. What is Bioinformatics ? ... The content of this exemplary online course covers major areas of Bioinformatics ...
University of Madras. Outline of Presentation. What is Bioinformatics ? ... The content of this exemplary online course covers major areas of Bioinformatics ...
| PowerPoint PPT presentation | free to download
Kingdom Alveolatae PowerPoint PPT Presentation
Kingdom Alveolatae - Series of sacs or alveoli underneath cell membranes ... http://www.geo.ucalgary.ca/~macrae/palynology/dinoflagellates/theca.gif. Ciliates ...
Series of sacs or alveoli underneath cell membranes ... http://www.geo.ucalgary.ca/~macrae/palynology/dinoflagellates/theca.gif. Ciliates ...
| PowerPoint PPT presentation | free to view
What is the Course About PowerPoint PPT Presentation
What is the Course About - and understanding of biological data. Bioinformatics is a relatively new ... A Computer Science Perspective. Recombinant DNA technology has created a revolution in ...
and understanding of biological data. Bioinformatics is a relatively new ... A Computer Science Perspective. Recombinant DNA technology has created a revolution in ...
| PowerPoint PPT presentation | free to view
INTRODUCTION TO METABOLIC ENGINEERING Chapter 1 of textbook PowerPoint PPT Presentation
INTRODUCTION TO METABOLIC ENGINEERING Chapter 1 of textbook - CE508 LECTURE ONE INTRODUCTION TO METABOLIC ENGINEERING Chapter 1 of textbook CE508 Metabolic Engineering Instructor Mattheos Koffas Course Information ...
CE508 LECTURE ONE INTRODUCTION TO METABOLIC ENGINEERING Chapter 1 of textbook CE508 Metabolic Engineering Instructor Mattheos Koffas Course Information ...
| PowerPoint PPT presentation | free to download
Fernando J. Martin-Sanchez, Ph. D. Head, Health Bioinformatics Dept. National Institute of Health PowerPoint PPT Presentation
Fernando J. Martin-Sanchez, Ph. D. Head, Health Bioinformatics Dept. National Institute of Health - Title: Sin t tulo de diapositiva Author: Fernando Mart n Last modified by: Fernando Mart n Created Date: 7/1/1999 8:58:12 PM Document presentation format
Title: Sin t tulo de diapositiva Author: Fernando Mart n Last modified by: Fernando Mart n Created Date: 7/1/1999 8:58:12 PM Document presentation format
| PowerPoint PPT presentation | free to view
Etude exploratoire des pratiques d PowerPoint PPT Presentation
Etude exploratoire des pratiques d - vocabulaire normalis sur la base de termes g n riques et de termes sp cifiques ... Faible co t cognitif (enfin une) Indexation orient e-t che. 1. 2. 3. 4. 5 ...
vocabulaire normalis sur la base de termes g n riques et de termes sp cifiques ... Faible co t cognitif (enfin une) Indexation orient e-t che. 1. 2. 3. 4. 5 ...
| PowerPoint PPT presentation | free to download
PowerPoint-Pr PowerPoint PPT Presentation
PowerPoint-Pr - PowerPoint-Pr sentation
PowerPoint-Pr sentation
| PowerPoint PPT presentation | free to download
The%20BIG%20Goal PowerPoint PPT Presentation
The%20BIG%20Goal - is important for studying the molecular basis. of diseases, diagnostics, developing drugs ... be monitored today using molecular techniques. The Tree of Life: ...
is important for studying the molecular basis. of diseases, diagnostics, developing drugs ... be monitored today using molecular techniques. The Tree of Life: ...
| PowerPoint PPT presentation | free to download
ELearning 2'0 Why the New Tools PowerPoint PPT Presentation
ELearning 2'0 Why the New Tools - RSS inside a Wiki Alan Levine. South African Curriculum on a wiki ... Alan Levine: New Learning Technologies Buffet. John Evans: IMYM Tutorials Wiki ...
RSS inside a Wiki Alan Levine. South African Curriculum on a wiki ... Alan Levine: New Learning Technologies Buffet. John Evans: IMYM Tutorials Wiki ...
| PowerPoint PPT presentation | free to download
Meharry Medical College Welcomes You PowerPoint PPT Presentation
Meharry Medical College Welcomes You - Meharry Medical College ' ... informatics. morphology. structural biology. A. P. H. A. R. M. C ... American Heart Association. ASPET. NARSAD. To be inspired: ...
Meharry Medical College ' ... informatics. morphology. structural biology. A. P. H. A. R. M. C ... American Heart Association. ASPET. NARSAD. To be inspired: ...
| PowerPoint PPT presentation | free to view
Microarray Statistics PowerPoint PPT Presentation
Microarray Statistics - Reverse engineering gene and protein regulatory networks using ... Deregulation carcinogenesis. Extensively studied in the literature gold standard network ...
Reverse engineering gene and protein regulatory networks using ... Deregulation carcinogenesis. Extensively studied in the literature gold standard network ...
| PowerPoint PPT presentation | free to view
Upconverting Labels in Biology PowerPoint PPT Presentation
Upconverting Labels in Biology - Need low phonon host for efficiency * 'Surface Engineering' is critical for UC particle ... wavelengths Whispering Gallery' standing. waves are established ...
Need low phonon host for efficiency * 'Surface Engineering' is critical for UC particle ... wavelengths Whispering Gallery' standing. waves are established ...
| PowerPoint PPT presentation | free to view
Sanger Institute: PowerPoint PPT Presentation
Sanger Institute: - Chromatin. mRNA RNA-bd prot. Transcripts. decay. rate. Proteins. transcription. rate. translation ... ribosome numbers associated with transcripts: ...
Chromatin. mRNA RNA-bd prot. Transcripts. decay. rate. Proteins. transcription. rate. translation ... ribosome numbers associated with transcripts: ...
| PowerPoint PPT presentation | free to view
Introduction to Molecular Biology and Genomics PowerPoint PPT Presentation
Introduction to Molecular Biology and Genomics - Pedigree for familial forms: Affected and Unaffected individuals. single loci? ... Identify differences, correlate to pedigree ...
Pedigree for familial forms: Affected and Unaffected individuals. single loci? ... Identify differences, correlate to pedigree ...
| PowerPoint PPT presentation | free to view
MACHINE LEARNING TECHNIQUES IN BIO-INFORMATICS PowerPoint PPT Presentation
MACHINE LEARNING TECHNIQUES IN BIO-INFORMATICS - Title: talk proteomics Author: Elena Marchiori Last modified by: elena Created Date: 3/28/2002 7:39:25 AM Document presentation format: On-screen Show
Title: talk proteomics Author: Elena Marchiori Last modified by: elena Created Date: 3/28/2002 7:39:25 AM Document presentation format: On-screen Show
| PowerPoint PPT presentation | free to download
E-Learning 2.0 PowerPoint PPT Presentation
E-Learning 2.0 - Practice and Reflection. Helen Barrett, Stephen Downes. Reflection. Allows us to Learn ... Reflection entails autonomy. Autonomy. Autonomy and motivation ...
Practice and Reflection. Helen Barrett, Stephen Downes. Reflection. Allows us to Learn ... Reflection entails autonomy. Autonomy. Autonomy and motivation ...
| PowerPoint PPT presentation | free to download
Bioinformatics: Applications PowerPoint PPT Presentation
Bioinformatics: Applications - Gene expression levels correspond to protein levels ... Precipitate Locally low signal Comet-tails (donut hole) Two Types of glass- microarrays ...
Gene expression levels correspond to protein levels ... Precipitate Locally low signal Comet-tails (donut hole) Two Types of glass- microarrays ...
| PowerPoint PPT presentation | free to view
Understanding Learning Networks, reprise PowerPoint PPT Presentation
Understanding Learning Networks, reprise - ELGG and blogging Miles Berry (a good way of promoting learner ... Pick an Acronym. Compare to This. How RSS Works. http://www.downes.ca/files/RSS_Educ.htm ...
ELGG and blogging Miles Berry (a good way of promoting learner ... Pick an Acronym. Compare to This. How RSS Works. http://www.downes.ca/files/RSS_Educ.htm ...
| PowerPoint PPT presentation | free to download
Fernando J. MartinSanchez, Ph. D. Head, Health Bioinformatics Dept. National Institute of Health Car PowerPoint PPT Presentation
Fernando J. MartinSanchez, Ph. D. Head, Health Bioinformatics Dept. National Institute of Health Car - Madrid, SPAIN. EC IST BIOINFOMED ... Sanchez - ISCIII Jun. 2002 - Madrid ... Martin-Sanchez - ISCIII Jun. 2002 - Madrid. The Post-Genomics Era. Genome ...
Madrid, SPAIN. EC IST BIOINFOMED ... Sanchez - ISCIII Jun. 2002 - Madrid ... Martin-Sanchez - ISCIII Jun. 2002 - Madrid. The Post-Genomics Era. Genome ...
| PowerPoint PPT presentation | free to view
BLOGS Des outils et des Hommes PowerPoint PPT Presentation
BLOGS Des outils et des Hommes - des catalogues et des OPACs actuels == sous utilis s == d valoris s ... des SIGB actuels. Remettre au c ur ... des dispositifs techniques. le SERVICE l'USAGER. ...
des catalogues et des OPACs actuels == sous utilis s == d valoris s ... des SIGB actuels. Remettre au c ur ... des dispositifs techniques. le SERVICE l'USAGER. ...
| PowerPoint PPT presentation | free to download
Etude exploratoire des pratiques d PowerPoint PPT Presentation
Etude exploratoire des pratiques d - vocabulaire normalis sur la base de termes g n riques et de termes sp cifiques ... ensemble structur de concepts. (...) organis s dans un graphe ...
vocabulaire normalis sur la base de termes g n riques et de termes sp cifiques ... ensemble structur de concepts. (...) organis s dans un graphe ...
| PowerPoint PPT presentation | free to download
UNIVERSIDADE FEDERAL DE JUIZ DE FORA PowerPoint PPT Presentation
UNIVERSIDADE FEDERAL DE JUIZ DE FORA - UNIVERSIDADE FEDERAL DE JUIZ DE FORA Departamento de Nutri o I Semana da Nutri o da UFJF Terceiro dia Uso do alimento na promo o da sa de
UNIVERSIDADE FEDERAL DE JUIZ DE FORA Departamento de Nutri o I Semana da Nutri o da UFJF Terceiro dia Uso do alimento na promo o da sa de
| PowerPoint PPT presentation | free to view
ProQuest Psychology Resources PowerPoint PPT Presentation
ProQuest Psychology Resources - Edited by Annette M. La Greca, Wendy K. Silverman, Eric M. Vernberg, and Michael C. Roberts ... LeAdelle Phelps, Ronald T. Brown, and Thomas J. Power ...
Edited by Annette M. La Greca, Wendy K. Silverman, Eric M. Vernberg, and Michael C. Roberts ... LeAdelle Phelps, Ronald T. Brown, and Thomas J. Power ...
| PowerPoint PPT presentation | free to view
Measuring Gene Expression PowerPoint PPT Presentation
Measuring Gene Expression - Genes are characterized using gene annotation tools (Pedant, Magpie, etc.) How Many? ... Complement of all genes in a cell, tissue, organ or organism. Transcriptome ...
Genes are characterized using gene annotation tools (Pedant, Magpie, etc.) How Many? ... Complement of all genes in a cell, tissue, organ or organism. Transcriptome ...
| PowerPoint PPT presentation | free to view
Etude exploratoire des pratiques d PowerPoint PPT Presentation
Etude exploratoire des pratiques d - Etude exploratoire des pratiques d indexation sociale comme une ren gociation des espaces documentaires. Observations D rive des continents documentaires .
Etude exploratoire des pratiques d indexation sociale comme une ren gociation des espaces documentaires. Observations D rive des continents documentaires .
| PowerPoint PPT presentation | free to download
Hier steht ein Titel. Dieser Titel kann auch drei Zeilen haben. PowerPoint PPT Presentation
Hier steht ein Titel. Dieser Titel kann auch drei Zeilen haben. - Title: Hier steht ein Titel. Dieser Titel kann auch drei Zeilen haben. Author: cmarkowitsch Last modified by: Ylva Huber Created Date: 3/21/2005 6:59:46 AM
Title: Hier steht ein Titel. Dieser Titel kann auch drei Zeilen haben. Author: cmarkowitsch Last modified by: Ylva Huber Created Date: 3/21/2005 6:59:46 AM
| PowerPoint PPT presentation | free to download
Open Educational Resources And The Personal Learning Environment PowerPoint PPT Presentation
Open Educational Resources And The Personal Learning Environment - What is an Open Educational Resource? ... of the Resource Discovery Network ... http://www-personal.umich.edu/~kborders/photography.htm. Recommender Systems ...
What is an Open Educational Resource? ... of the Resource Discovery Network ... http://www-personal.umich.edu/~kborders/photography.htm. Recommender Systems ...
| PowerPoint PPT presentation | free to view
Dia 1 PowerPoint PPT Presentation
Dia 1 - 1978: First meeting of European Pharmacy students during the GA of ANEPF held in ... EPSA represents over 120 000 pharmacy students in all the countries of the ...
1978: First meeting of European Pharmacy students during the GA of ANEPF held in ... EPSA represents over 120 000 pharmacy students in all the countries of the ...
| PowerPoint PPT presentation | free to view
Systems Biology PowerPoint PPT Presentation
Systems Biology - Systems Biology
Systems Biology
| PowerPoint PPT presentation | free to view
FISH BIOL 340 PowerPoint PPT Presentation
FISH BIOL 340 - School of Aquatic and Fishery Sciences. Marine Studies, room 207 ... piping plover. Why use molecular markers ? Molecular markers are heritable ...
School of Aquatic and Fishery Sciences. Marine Studies, room 207 ... piping plover. Why use molecular markers ? Molecular markers are heritable ...
| PowerPoint PPT presentation | free to view
Hier steht ein Titel. Dieser Titel kann auch drei Zeilen haben. PowerPoint PPT Presentation
Hier steht ein Titel. Dieser Titel kann auch drei Zeilen haben. - ... International ... MAJOR THREATS TO PUBLIC HEALTH. 2. Potentially new and re-emerging ... and access to information. Brokering research into policy. ...
... International ... MAJOR THREATS TO PUBLIC HEALTH. 2. Potentially new and re-emerging ... and access to information. Brokering research into policy. ...
| PowerPoint PPT presentation | free to view
Engineering at the National Science Foundation PowerPoint PPT Presentation
Engineering at the National Science Foundation - 'To Promote Progress of Science' and 'Advance National Health, Prosperity ... Infrastructure construction and management, geotechnology, structures ...
'To Promote Progress of Science' and 'Advance National Health, Prosperity ... Infrastructure construction and management, geotechnology, structures ...
| PowerPoint PPT presentation | free to view
Engineering at the National Science Foundation PowerPoint PPT Presentation
Engineering at the National Science Foundation - Prevention, Detection, & Remediation of NCB Threats ... Bob Jaeger. Biomedical. Engineering. Semahat Demir. Biophotonics, Advanced Imaging ...
Prevention, Detection, & Remediation of NCB Threats ... Bob Jaeger. Biomedical. Engineering. Semahat Demir. Biophotonics, Advanced Imaging ...
| PowerPoint PPT presentation | free to view
John Doyle PowerPoint PPT Presentation
John Doyle - John Doyle. Control and Dynamical Systems, Electrical Engineering, Bioengineering ... Both will include physics, biology, and networking. Two great ...
John Doyle. Control and Dynamical Systems, Electrical Engineering, Bioengineering ... Both will include physics, biology, and networking. Two great ...
| PowerPoint PPT presentation | free to view
Professor Ales Prokop PowerPoint PPT Presentation
Professor Ales Prokop - Professor Ales Prokop Research Professor: Vanderbilt University Department of Chemical Engineering Professor Ales Prokop Research Professor: Vanderbilt University ...
Professor Ales Prokop Research Professor: Vanderbilt University Department of Chemical Engineering Professor Ales Prokop Research Professor: Vanderbilt University ...
| PowerPoint PPT presentation | free to view
Gene Network Modeling PowerPoint PPT Presentation
Gene Network Modeling - Gene Network Modeling Prof. Yasser Kadah Eng. Fadhl Al-Akwaa OUTLINES What is the Gene Regulatory Network? GRN Application of GRN GRN Construction Methodology GRN ...
Gene Network Modeling Prof. Yasser Kadah Eng. Fadhl Al-Akwaa OUTLINES What is the Gene Regulatory Network? GRN Application of GRN GRN Construction Methodology GRN ...
| PowerPoint PPT presentation | free to download
http://nature-wonder.livejournal.com/192600.html PowerPoint PPT Presentation
http://nature-wonder.livejournal.com/192600.html - , 2010-2020 http://nature-wonder.livejournal.com/192600.html Red Blood Cells Carry oxygen from the lungs.
, 2010-2020 http://nature-wonder.livejournal.com/192600.html Red Blood Cells Carry oxygen from the lungs.
| PowerPoint PPT presentation | free to download
Current and Emerging Infectious Diseases PowerPoint PPT Presentation
Current and Emerging Infectious Diseases - West Nile Virus This vaccine protects monkeys and horses against WNV infection, and a clinical trial is now underway. Subunit and DNA vaccines against WNV are also ...
West Nile Virus This vaccine protects monkeys and horses against WNV infection, and a clinical trial is now underway. Subunit and DNA vaccines against WNV are also ...
| PowerPoint PPT presentation | free to view
John Doyle PowerPoint PPT Presentation
John Doyle - John Doyle. Control and Dynamical Systems, Electrical Engineering, Bioengineering ... Biology: Csete,Yi, Borisuk, Bolouri, Kitano, Kurata, Khammash, El-Samad, Gross, ...
John Doyle. Control and Dynamical Systems, Electrical Engineering, Bioengineering ... Biology: Csete,Yi, Borisuk, Bolouri, Kitano, Kurata, Khammash, El-Samad, Gross, ...
| PowerPoint PPT presentation | free to view
Hier steht ein Titel. Dieser Titel kann auch drei Zeilen haben. PowerPoint PPT Presentation
Hier steht ein Titel. Dieser Titel kann auch drei Zeilen haben. - 2nd Call in HEALTH in FP7. Astrid Hoebertz. European and International Programmes ... Molecular epidemiology to control nosocomial and community spreading of highly ...
2nd Call in HEALTH in FP7. Astrid Hoebertz. European and International Programmes ... Molecular epidemiology to control nosocomial and community spreading of highly ...
| PowerPoint PPT presentation | free to view
Folie 1 PowerPoint PPT Presentation
Folie 1 - ... have to reach the course organizer Kari Hemminki (k.hemminki@dkfz.de) by ... Jaakko Kaprio (Helsinki), Matti Lehtinen (Tampere), Kari Hemminki (Heidelberg) ...
... have to reach the course organizer Kari Hemminki (k.hemminki@dkfz.de) by ... Jaakko Kaprio (Helsinki), Matti Lehtinen (Tampere), Kari Hemminki (Heidelberg) ...
| PowerPoint PPT presentation | free to view


Home About Us Terms and Conditions Privacy Policy Contact Us
Copyright 2024 CrystalGraphics, Inc. — All rights Reserved. PowerShow.com is a trademark of CrystalGraphics, Inc.
postgenomic — Search results on PowerShow.com