521 Zebrafish PPTs View free & download

Zebrafish as a

| PowerPoint PPT presentation | free to view

Zebrafish Jeopardy PowerPoint PPT Presentation

Zebrafish Jeopardy - Zebrafish Jeopardy General Characteristics for 100 Name this structure What is Blastodisc? Cell Movements for 100 During the gastrula stage, this ...

Zebrafish Jeopardy General Characteristics for 100 Name this structure What is Blastodisc? Cell Movements for 100 During the gastrula stage, this ...

| PowerPoint PPT presentation | free to download

Zebrafish Danio rerio - Zebrafish Danio rerio

Zebrafish Danio rerio

| PowerPoint PPT presentation | free to view

Zebrafish model in toxicology - Zebrafish model in toxicology

Zebrafish model in toxicology

| PowerPoint PPT presentation | free to view

Zebrafish Genome Resources Workshop PowerPoint PPT Presentation

Zebrafish Genome Resources Workshop - Zebrafish Genome Resources Workshop. Mario Caccamo ... www.ncbi.nih.gov/genome/guide/zebrafish/ ZFIN ... Zebrafish Genome Resources Workshop - Dresden 2005 ...

Zebrafish Genome Resources Workshop. Mario Caccamo ... www.ncbi.nih.gov/genome/guide/zebrafish/ ZFIN ... Zebrafish Genome Resources Workshop - Dresden 2005 ...

| PowerPoint PPT presentation | free to view

The Zebrafish Genome Sequencing Project Bioinformatics resources PowerPoint PPT Presentation

The Zebrafish Genome Sequencing Project Bioinformatics resources - Kerstin Howe, Mario Caccamo, Ian Sealy The Zebrafish Genome Sequencing Project Bioinformatics resources mis-joins and other complications change of strategy from Zv2 ...

Kerstin Howe, Mario Caccamo, Ian Sealy The Zebrafish Genome Sequencing Project Bioinformatics resources mis-joins and other complications change of strategy from Zv2 ...

| PowerPoint PPT presentation | free to download

ZEBRAFISH GENETICS AND DEVELOPMENT PowerPoint PPT Presentation

ZEBRAFISH GENETICS AND DEVELOPMENT - 'A small population of anterior cells patterns the forebrain during zebrafish ... Noggin. Bmp. Bmp. The organizer expresses factors that induce neural tissue by ...

'A small population of anterior cells patterns the forebrain during zebrafish ... Noggin. Bmp. Bmp. The organizer expresses factors that induce neural tissue by ...

| PowerPoint PPT presentation | free to view

Nicotine Developmental Toxicity in Zebrafish - Nicotine Developmental Toxicity in Zebrafish

Nicotine Developmental Toxicity in Zebrafish

| PowerPoint PPT presentation | free to view

Zebrafish Genome Resources Workshop - The workshops are concurrent with the poster sessions on the 14th and 15th. ... Thursday - 14th July 2005 - Salon Zwinger / Semper ...

The workshops are concurrent with the poster sessions on the 14th and 15th. ... Thursday - 14th July 2005 - Salon Zwinger / Semper ...

| PowerPoint PPT presentation | free to view

Identifying Bacteria In Zebrafish PowerPoint PPT Presentation

Identifying Bacteria In Zebrafish - To identify the bacteria which is infecting a particular zebrafish. Hypothesis ... Zebrafish used for the specimin was infected eith Aeromonas. ...

To identify the bacteria which is infecting a particular zebrafish. Hypothesis ... Zebrafish used for the specimin was infected eith Aeromonas. ...

| PowerPoint PPT presentation | free to view

Zebrafish Biology, Health, and Diseases - Zebrafish Biology, Health, and Diseases

Zebrafish Biology, Health, and Diseases

| PowerPoint PPT presentation | free to view

Zebrafish and the IACUC PowerPoint PPT Presentation

Zebrafish and the IACUC - Veterinarians. Animal Facilities. Principle Investigators ... Veterinarian with interest in integrating zebrafish. Collaboration between a facility manager and ...

Veterinarians. Animal Facilities. Principle Investigators ... Veterinarian with interest in integrating zebrafish. Collaboration between a facility manager and ...

| PowerPoint PPT presentation | free to view

The Role of miR7 in the Zebrafish Pituitary - The Role of miR7 in the Zebrafish Pituitary

The Role of miR7 in the Zebrafish Pituitary

| PowerPoint PPT presentation | free to view

An Investigation on the Toxicity of Aluminum in Zebrafish - An Investigation on the Toxicity of Aluminum in Zebrafish

An Investigation on the Toxicity of Aluminum in Zebrafish

| PowerPoint PPT presentation | free to view

NMDA receptor blockade increases locomotor behavior in the zebrafish PowerPoint PPT Presentation

NMDA receptor blockade increases locomotor behavior in the zebrafish - Zebrafish larvae placed into single wells of a multi well plate ... Zebrafish may prove useful for elucidating important molecular pathways of drug abuse ...

Zebrafish larvae placed into single wells of a multi well plate ... Zebrafish may prove useful for elucidating important molecular pathways of drug abuse ...

| PowerPoint PPT presentation | free to view

RADIATION HYBRID MAP OF THE ZEBRAFISH GENOME PowerPoint PPT Presentation

RADIATION HYBRID MAP OF THE ZEBRAFISH GENOME - Somatic cell genetic technique used to construct long range maps of ... Survey Sequencing and Dense Radiation-Hybrid Gene Mapping, Christophe Hitte, Et. ...

Somatic cell genetic technique used to construct long range maps of ... Survey Sequencing and Dense Radiation-Hybrid Gene Mapping, Christophe Hitte, Et. ...

| PowerPoint PPT presentation | free to view

The Zebrafish as a Mainstream Laboratory Animal PowerPoint PPT Presentation

The Zebrafish as a Mainstream Laboratory Animal - Focus of laboratory animal science on mammalian species ... Laboratory Animal Science: 'Mammalian-Centric' ... Laboratory Animal Science: 'Mammalian-centric' ...

Focus of laboratory animal science on mammalian species ... Laboratory Animal Science: 'Mammalian-Centric' ... Laboratory Animal Science: 'Mammalian-centric' ...

| PowerPoint PPT presentation | free to view

Genetics of leftright asymmetry in the zebrafish brain - Genetics of leftright asymmetry in the zebrafish brain

Genetics of leftright asymmetry in the zebrafish brain

| PowerPoint PPT presentation | free to view

The Expression Profile of NET1 in WT zebrafish embryos - The Expression Profile of NET1 in WT zebrafish embryos (a) The Expression Profile of RhoGEF: ... 50% Epiboly Zebrafish treated with 8ng NET1-long Morpholino ...

The Expression Profile of NET1 in WT zebrafish embryos (a) The Expression Profile of RhoGEF: ... 50% Epiboly Zebrafish treated with 8ng NET1-long Morpholino ...

| PowerPoint PPT presentation | free to view

Utility and use of zebrafish as model for understanding angiogenesis' - Utility and use of zebrafish as model for understanding angiogenesis'

Utility and use of zebrafish as model for understanding angiogenesis'

| PowerPoint PPT presentation | free to view

Automated Segmentation and Classification of Zebrafish Histology Images for HighThroughput Phenotypi - Automated Segmentation and Classification of Zebrafish Histology Images for HighThroughput Phenotypi

Automated Segmentation and Classification of Zebrafish Histology Images for HighThroughput Phenotypi

| PowerPoint PPT presentation | free to view

GFP tagged Zebrafish a model for heat shock protein studies PowerPoint PPT Presentation

GFP tagged Zebrafish a model for heat shock protein studies - One -sheet with alpha helix(s) containing the chromophore running through the center. ... Form a part of cell's own repair system, called the 'cellular stress response' or the ' ...

One -sheet with alpha helix(s) containing the chromophore running through the center. ... Form a part of cell's own repair system, called the 'cellular stress response' or the ' ...

| PowerPoint PPT presentation | free to view

Alphaparticleinduced bystander effects between zebrafish embryos in vivo PowerPoint PPT Presentation

Alphaparticleinduced bystander effects between zebrafish embryos in vivo - ... on bystander effect in vivo in mice and in fish ... 0.5 Gy X-ray ... Communication of Radiation-induced Stress or Bystander Signals between Fish in Vivo. ...

... on bystander effect in vivo in mice and in fish ... 0.5 Gy X-ray ... Communication of Radiation-induced Stress or Bystander Signals between Fish in Vivo. ...

| PowerPoint PPT presentation | free to download

Zebrafish, an alternative to the mouse for genetic studies of vertebrate development. PowerPoint PPT Presentation

Zebrafish, an alternative to the mouse for genetic studies of vertebrate development. - ... the screen, they predict about 2400 genes that can mutate to embryonic lethality. ... Screen for disruptions of essential genes (lethal mutations) ...

... the screen, they predict about 2400 genes that can mutate to embryonic lethality. ... Screen for disruptions of essential genes (lethal mutations) ...

| PowerPoint PPT presentation | free to view

Cloning and Sequencing of Danio rerio (zebrafish) Polycomb Gene Using Polymerase Chain Reaction (PCR) PowerPoint PPT Presentation

Cloning and Sequencing of Danio rerio (zebrafish) Polycomb Gene Using Polymerase Chain Reaction (PCR) - Cloning and Sequencing of Danio rerio (zebrafish) Polycomb Gene Using Polymerase ... comparing gene and protein sequences against others in public databases (GenBank) ...

Cloning and Sequencing of Danio rerio (zebrafish) Polycomb Gene Using Polymerase ... comparing gene and protein sequences against others in public databases (GenBank) ...

| PowerPoint PPT presentation | free to view

Selective Estrogen Receptor Modulators Cause Abnormal Skeletal Development in the Zebrafish Danio re PowerPoint PPT Presentation

Selective Estrogen Receptor Modulators Cause Abnormal Skeletal Development in the Zebrafish Danio re - Embryonic zebrafish were shipped from Oregon and dechorinated (removal of the ... Estrogen is important to skeletal development in the zebrafish. ...

Embryonic zebrafish were shipped from Oregon and dechorinated (removal of the ... Estrogen is important to skeletal development in the zebrafish. ...

| PowerPoint PPT presentation | free to view

GAP JUNCTION COMMUNICATION IN THE DEVELOPING ZEBRAFISH NOTOCHORD Judson D' Sheridan, Alison Krufka, PowerPoint PPT Presentation

GAP JUNCTION COMMUNICATION IN THE DEVELOPING ZEBRAFISH NOTOCHORD Judson D' Sheridan, Alison Krufka, - GAP JUNCTION COMMUNICATION IN THE DEVELOPING ZEBRAFISH NOTOCHORD ... Zebrafish embryos of stages 10 somites (14 embryos) or 24 hr (27 embryos) were ...

GAP JUNCTION COMMUNICATION IN THE DEVELOPING ZEBRAFISH NOTOCHORD ... Zebrafish embryos of stages 10 somites (14 embryos) or 24 hr (27 embryos) were ...

| PowerPoint PPT presentation | free to view

Thinking Outside the Box: Is Automated Feeding Doable for Large Zebrafish Facilities - Thinking Outside the Box: Is Automated Feeding Doable for Large Zebrafish Facilities

Thinking Outside the Box: Is Automated Feeding Doable for Large Zebrafish Facilities

| PowerPoint PPT presentation | free to view

Fig' 1: Zebrafish Genetics Laboratory located at room 210 of Nursing building is established' PowerPoint PPT Presentation

Fig' 1: Zebrafish Genetics Laboratory located at room 210 of Nursing building is established' - Fig. 1: Zebrafish Genetics Laboratory located at room 210 of Nursing building is ... Fig. 3 The recapitulation of reporter GFP pattern with endogenous Nav1.6 ...

Fig. 1: Zebrafish Genetics Laboratory located at room 210 of Nursing building is ... Fig. 3 The recapitulation of reporter GFP pattern with endogenous Nav1.6 ...

| PowerPoint PPT presentation | free to view

Establishment of Spatial Pattern: Pigment Pattern Development in the Zebrafish PowerPoint PPT Presentation

Establishment of Spatial Pattern: Pigment Pattern Development in the Zebrafish - Presented by Tasha Hanes. March 20, 2002. Pattern formation 'process by which cells in a developing embryo acquire identities that lead to a ...

Presented by Tasha Hanes. March 20, 2002. Pattern formation 'process by which cells in a developing embryo acquire identities that lead to a ...

| PowerPoint PPT presentation | free to view

Strategy for Identifying and Sequencing the Polycomb Gene in Danio rerio Zebrafish PowerPoint PPT Presentation

Strategy for Identifying and Sequencing the Polycomb Gene in Danio rerio Zebrafish - Celeste Nadal, YW Peter Lin, Gerhild Packert and Teresa Petrino ... Regulates gene expression by ... MELPAVG-EHVFAVESIEKKRIRKGRVEYLVKWRGW 35 Xenopus laevis ...

Celeste Nadal, YW Peter Lin, Gerhild Packert and Teresa Petrino ... Regulates gene expression by ... MELPAVG-EHVFAVESIEKKRIRKGRVEYLVKWRGW 35 Xenopus laevis ...

| PowerPoint PPT presentation | free to view

The Characterization of RhoGEFs and The Role of NET1 in Zebrafish Gastrulation PowerPoint PPT Presentation

The Characterization of RhoGEFs and The Role of NET1 in Zebrafish Gastrulation - The Characterization of RhoGEFs and The Role of NET1 in Zebrafish Gastrulation ... The Gastrulation Period of Zebrafish Embryonic Development ...

The Characterization of RhoGEFs and The Role of NET1 in Zebrafish Gastrulation ... The Gastrulation Period of Zebrafish Embryonic Development ...

| PowerPoint PPT presentation | free to view

Development of DA and 5HT neurons involved in rewardassociated behavior in zebrafish PowerPoint PPT Presentation

Development of DA and 5HT neurons involved in rewardassociated behavior in zebrafish - Studying reward-associated behavior in larval zebrafish. Larval zebrafish are amenable to genetic analysis and the study of cellular mechanisms ...

Studying reward-associated behavior in larval zebrafish. Larval zebrafish are amenable to genetic analysis and the study of cellular mechanisms ...

| PowerPoint PPT presentation | free to view

Zebrafish cdx1b regulates expression of downstream factors of Nodal signaling during early endoderm PowerPoint PPT Presentation

Zebrafish cdx1b regulates expression of downstream factors of Nodal signaling during early endoderm - We identified a zebrafish caudal-related homeobox (cdx1b) gene which shares ... in intron 1 of the foxa2 gene based on an electrophoretic mobility shift assay. ...

We identified a zebrafish caudal-related homeobox (cdx1b) gene which shares ... in intron 1 of the foxa2 gene based on an electrophoretic mobility shift assay. ...

| PowerPoint PPT presentation | free to view

Cloning of Zebrafish b4 Splice Variants. Cloning of first strand RACEready cDNA encoding b4 subunits PowerPoint PPT Presentation

Cloning of Zebrafish b4 Splice Variants. Cloning of first strand RACEready cDNA encoding b4 subunits - Cloning of Zebrafish b4 Splice Variants. Cloning of first strand RACE-ready cDNA ... MOLECULAR CLONING OF ZEBRAFISH CALCIUM CHANNEL. b4 SUBUNIT SPLICE VARIANTS ...

Cloning of Zebrafish b4 Splice Variants. Cloning of first strand RACE-ready cDNA ... MOLECULAR CLONING OF ZEBRAFISH CALCIUM CHANNEL. b4 SUBUNIT SPLICE VARIANTS ...

| PowerPoint PPT presentation | free to view

Comparative Analysis of Human Chromosome 22q11.1-q12.3 with Syntenic Regions in the Chimpanzee, Baboon, Bovine, Mouse, Pufferfish and Zebrafish Genomes - Comparative Analysis of Human Chromosome 22q11.1-q12.3 with Syntenic Regions in the Chimpanzee, Baboon, Bovine, Mouse, Pufferfish and Zebrafish Genomes

Comparative Analysis of Human Chromosome 22q11.1-q12.3 with Syntenic Regions in the Chimpanzee, Baboon, Bovine, Mouse, Pufferfish and Zebrafish Genomes

| PowerPoint PPT presentation | free to view

Gastrulation PowerPoint PPT Presentation

Gastrulation - Gastrulation - Zebrafish. Animal Pole: contains the nucleus and most of ... Zebrafish ... PCP and zebrafish development. Fz/PCP driven Cell Motility. Cell ...

Gastrulation - Zebrafish. Animal Pole: contains the nucleus and most of ... Zebrafish ... PCP and zebrafish development. Fz/PCP driven Cell Motility. Cell ...

| PowerPoint PPT presentation | free to view

Lexical Issues in Anatomical Ontologies PowerPoint PPT Presentation

Lexical Issues in Anatomical Ontologies - To support access to tissue-based genetic ... Zebrafish: ~1200 anatomical parts. Human: 2328 anatomical parts ... Zebrafish is also working on this. ...

To support access to tissue-based genetic ... Zebrafish: ~1200 anatomical parts. Human: 2328 anatomical parts ... Zebrafish is also working on this. ...

| PowerPoint PPT presentation | free to download

all.joiner - set fish tetraodon,fugu,zebrafish. set worms elegans,briggsae ... tetraodon,fugu,zebrafish,elegans,briggsae. Databases by organism ...

set fish tetraodon,fugu,zebrafish. set worms elegans,briggsae ... tetraodon,fugu,zebrafish,elegans,briggsae. Databases by organism ...

| PowerPoint PPT presentation | free to download

Normalization of microarray data PowerPoint PPT Presentation

Normalization of microarray data - ... ratios from 4 red-green 8448-clone cDNA arrays hybridised with zebrafish samples. ... zebrafish data. Loess regression. Locally weighted regression. ...

... ratios from 4 red-green 8448-clone cDNA arrays hybridised with zebrafish samples. ... zebrafish data. Loess regression. Locally weighted regression. ...

| PowerPoint PPT presentation | free to download

1 of 29 - Sanger: zebrafish. Broad Institute: mammals. Baylor College: cow. Washington University: chicken ... Zebrafish. Many duplications. Genome from different ...

Sanger: zebrafish. Broad Institute: mammals. Baylor College: cow. Washington University: chicken ... Zebrafish. Many duplications. Genome from different ...

| PowerPoint PPT presentation | free to view

Bioinformatique:%20Projets%20g PowerPoint PPT Presentation

Bioinformatique:%20Projets%20g - Identify genes and other functional elements (regulatory ... Caenorhabditis elegans (nematode) Lycopersicon esculentum (tomato) Danio rerio (zebrafish) ...

Identify genes and other functional elements (regulatory ... Caenorhabditis elegans (nematode) Lycopersicon esculentum (tomato) Danio rerio (zebrafish) ...

| PowerPoint PPT presentation | free to download

Axon guidance PowerPoint PPT Presentation

Axon guidance - Mauthner cell axon labeled with DiI in the spinal cord of a zebrafish embryo ... in zebrafish. Lipophilic axon tracers. DiI (di-C18-...indo-carbocyanine) ...

Mauthner cell axon labeled with DiI in the spinal cord of a zebrafish embryo ... in zebrafish. Lipophilic axon tracers. DiI (di-C18-...indo-carbocyanine) ...

| PowerPoint PPT presentation | free to view

The Evolution and Genomics of Cytochrome P450 PowerPoint PPT Presentation

The Evolution and Genomics of Cytochrome P450 - The AmpliChip CYP450 array from Roche. The first pharmacogenomics diagnostic chip ... Fugu CYP2Y1 and CYP2Y2. Zebrafish CYP2Y3. zebrafish CYP19 and gliomedin ortholog ...

The AmpliChip CYP450 array from Roche. The first pharmacogenomics diagnostic chip ... Fugu CYP2Y1 and CYP2Y2. Zebrafish CYP2Y3. zebrafish CYP19 and gliomedin ortholog ...

| PowerPoint PPT presentation | free to view

TAGGO: a Tool for Automatic Grouping of Gene Ontology Annotations PowerPoint PPT Presentation

TAGGO: a Tool for Automatic Grouping of Gene Ontology Annotations - Genomes of seven (7) species supplied: Human, Mouse, Rat, Arabidopsis, Zebrafish, Chicken, Cow ... Zebrafish. Exclude entries. with undesired ECs. GO ...

Genomes of seven (7) species supplied: Human, Mouse, Rat, Arabidopsis, Zebrafish, Chicken, Cow ... Zebrafish. Exclude entries. with undesired ECs. GO ...

| PowerPoint PPT presentation | free to view

Nuclear receptors and circadian rhythms PowerPoint PPT Presentation

Nuclear receptors and circadian rhythms - Circadian expression of Rev-erba during Zebrafish development. post-natal. mammals. zebrafish ... Expression of Rev-erba in zebrafish epiphysis and retina. 72 hpf ...

Circadian expression of Rev-erba during Zebrafish development. post-natal. mammals. zebrafish ... Expression of Rev-erba in zebrafish epiphysis and retina. 72 hpf ...

| PowerPoint PPT presentation | free to view

Lateral Line Sensitivity: An Experimental Evolution Approach PowerPoint PPT Presentation

Lateral Line Sensitivity: An Experimental Evolution Approach - Morpholinos are now available for highly selective gene knockdown in zebrafish. ... Zebrafish = 3 months to maturity after fertilization ...

Morpholinos are now available for highly selective gene knockdown in zebrafish. ... Zebrafish = 3 months to maturity after fertilization ...

| PowerPoint PPT presentation | free to view

Carl Smith - The zebrafish a behavioural model? Why zebrafish should be used ... It's a carp. Aquaculture. Research. Great interest ...and why they shouldn't ...

The zebrafish a behavioural model? Why zebrafish should be used ... It's a carp. Aquaculture. Research. Great interest ...and why they shouldn't ...

| PowerPoint PPT presentation | free to view

PaTO: Towards a description of organismal Phenotypes eGenomics meeting September 12th, 2006 PowerPoint PPT Presentation

PaTO: Towards a description of organismal Phenotypes eGenomics meeting September 12th, 2006 - Motivation for formalized phenotype description and ... Zebrafish. shh. Zebrafish. oep. Who should use PATO? Originally: model organism mutant phenotypes ...

Motivation for formalized phenotype description and ... Zebrafish. shh. Zebrafish. oep. Who should use PATO? Originally: model organism mutant phenotypes ...

| PowerPoint PPT presentation | free to view

Podocyte Loss and Glomerulosclerosis in Inducible Mouse Model of Podocin Mutation-Related Nephrotic Syndrome PowerPoint PPT Presentation

Podocyte Loss and Glomerulosclerosis in Inducible Mouse Model of Podocin Mutation-Related Nephrotic Syndrome - Title: Mutations in SIX2 and BMP4 are associated with abnormal kidney development in humans and zebrafish Author: tabatabaeimansoureh Last modified by

Title: Mutations in SIX2 and BMP4 are associated with abnormal kidney development in humans and zebrafish Author: tabatabaeimansoureh Last modified by

| PowerPoint PPT presentation | free to view

Toxicity of Dendrimers PowerPoint PPT Presentation

Toxicity of Dendrimers - What is the developmental toxicity of G3.5 and G4.0 dendrimers in zebrafish? ... Confirmed that zebrafish is a good system for assessing toxicity ...

What is the developmental toxicity of G3.5 and G4.0 dendrimers in zebrafish? ... Confirmed that zebrafish is a good system for assessing toxicity ...

| PowerPoint PPT presentation | free to view

Single Nucleotide Polymorphism PowerPoint PPT Presentation

Single Nucleotide Polymorphism - Single Nucleotide Polymorphism. Anshu Bhardwaj. Research Fellow ... (http://zebrafish.doc.ic.ac.uk/Sean/) SNP Finder: For analyzing user-submitted. trace data ...

Single Nucleotide Polymorphism. Anshu Bhardwaj. Research Fellow ... (http://zebrafish.doc.ic.ac.uk/Sean/) SNP Finder: For analyzing user-submitted. trace data ...

| PowerPoint PPT presentation | free to download

Project Ubermensch PowerPoint PPT Presentation

Project Ubermensch - Project Ubermensch * A Leap Towards Regeneration Regeneration Imagine a world Organs Limbs Spinal cord Many organisms can! Salamanders, zebrafish, planarian ...

Project Ubermensch * A Leap Towards Regeneration Regeneration Imagine a world Organs Limbs Spinal cord Many organisms can! Salamanders, zebrafish, planarian ...

| PowerPoint PPT presentation | free to download

A Field Guide to GenBank and NCBI Molecular Biology Resources PowerPoint PPT Presentation

A Field Guide to GenBank and NCBI Molecular Biology Resources - A Field Guide to GenBank and NCBI Molecular Biology Resources. slightly modified from ... human, mouse, rat, fruit fly, zebrafish, arabidopsis. Human model ...

A Field Guide to GenBank and NCBI Molecular Biology Resources. slightly modified from ... human, mouse, rat, fruit fly, zebrafish, arabidopsis. Human model ...

| PowerPoint PPT presentation | free to download

Diapositiva 1 PowerPoint PPT Presentation

Diapositiva 1 - Different model organisms have proved useful for ... (Drosophila), and, more recently, vertebrates such as zebrafish and mice. A model organism Self-pollination and ...

Different model organisms have proved useful for ... (Drosophila), and, more recently, vertebrates such as zebrafish and mice. A model organism Self-pollination and ...

| PowerPoint PPT presentation | free to download

Kevin M' Crofton PowerPoint PPT Presentation

Kevin M' Crofton - Apoptosis in zebrafish embryo brain measured by image analysis of acridine orange staining ... g., C. elegans, Medaka, Zebrafish) Demonstration of proof-of ...

Apoptosis in zebrafish embryo brain measured by image analysis of acridine orange staining ... g., C. elegans, Medaka, Zebrafish) Demonstration of proof-of ...

| PowerPoint PPT presentation | free to view

Zebrafish PowerPoint PPT Presentations