Polycomb PowerPoint PPT Presentations
All Time
Recommended
Cell fates are specified by particular combinations of homeotic gene ... PcG mediated gene silencing can be ... Ezh1; Ezh2 (human); clf (Arabidopsis) extra sex ...
| PowerPoint PPT presentation | free to view
Cloning and Sequencing of Danio rerio (zebrafish) Polycomb Gene Using Polymerase ... comparing gene and protein sequences against others in public databases (GenBank) ...
| PowerPoint PPT presentation | free to view
Celeste Nadal, YW Peter Lin, Gerhild Packert and Teresa Petrino ... Regulates gene expression by ... MELPAVG-EHVFAVESIEKKRIRKGRVEYLVKWRGW 35 Xenopus laevis ...
| PowerPoint PPT presentation | free to view
The Drosophila SWI/SNF ATPase Brahma localizes to active regions of the genome ... 'Imitation switch' isolated first in Drosophila by homology with SWI/SNF ...
| PowerPoint PPT presentation | free to view
Histones have repressive post ... Endogenous Fab-7. Endogenous Fab-7 ... Endogenous Fab-7 at the BX-C (Chr.III) 3mm. Fab-X. Fab-X; Fab-71. WT. WT. Fab ...
| PowerPoint PPT presentation | free to view
Non-coding RNA characterization Roles in X-chromosome inactivation This paper sought to reveal the mechanisms by which Xist silences the X chromosome.
| PowerPoint PPT presentation | free to download
... Epigenetic Modifications Within an Arabidopsis Chromosome Heterochromatin correlates with epigenetic marks DNA ... Mechanisms for Repression Mediated ...
| PowerPoint PPT presentation | free to view
Epigenetics: Modification of DNA and chromatin to control DNA structure and Gene Expression Histone modifying enzymes often are part of large multi-subunit complexes.
| PowerPoint PPT presentation | free to download
Title: PcG, trxG and the maintenance of gene expression Author: Cavalli Giacomo Last modified by: Giacomo Cavalli Created Date: 9/26/2002 9:25:45 PM
| PowerPoint PPT presentation | free to view
the rest is transcriptionally inactive/silenced (but can be activated in certain ... Group 2 (Fenton - How): de Napoles et al, 2004, Dev. Cell 7: 663-676 ...
| PowerPoint PPT presentation | free to view
Chromatin and Epigenetics
| PowerPoint PPT presentation | free to view
FACTS: Less than 2% of the human genome encodes proteins Recent evidence from genomic tiling arrays and transcriptome deep sequencing showed that 50% of the human ...
| PowerPoint PPT presentation | free to download
Model of Drosophila Anterior-Posterior Pattern Formation Maternal effect genes Zygotic genes Syncytial blastoderm Cellular blastoderm Homeotic transformation of the ...
| PowerPoint PPT presentation | free to view
Using the genome Studying expression of all genes simultaneously Microarrays: reverse Northerns High-throughput sequencing Bisulfite sequencing to detect C ...
| PowerPoint PPT presentation | free to download
Weighted Correlation Network Analysis and Systems Biologic Applications Steve Horvath University of California, ... e.g. protein-protein interaction networks.
| PowerPoint PPT presentation | free to view
... Circadian Clock Photoperiodism 1 2 2 3 3 Germination, flowering, bud setting, tuberization, leaf senescence, juvenile to adult transition External factors: ...
| PowerPoint PPT presentation | free to download
The Retinoblastoma Protein
| PowerPoint PPT presentation | free to view
Biotech Research & Innovation Centre. Symbion Science Park Fruebjergvej 3 2100 ... human diploid fibroblasts (Tig3) -irradiation (10GY) UVC (25 J/m2) non. stressed ...
| PowerPoint PPT presentation | free to view
Changes in day length are a reliable indicator of seasonal progression, but day ... In Drosophila, PcG proteins act in large protein complexes. ...
| PowerPoint PPT presentation | free to view
Epigenomic views of human disease reveal 1000s of regulatory variants Manolis Kellis Broad Institute of MIT and Harvard MIT Computer Science & Artificial Intelligence ...
| PowerPoint PPT presentation | free to download
Homeotic transformation of the wing and haltere ... Perivitelline space. Fig. 31-16. The dorsal-ventral pathway. Maternal genes ...
| PowerPoint PPT presentation | free to view
... Post transcriptional gene silencing (PTGS) Co ... (dcr1) RNA dependent RNA polymerase (rdp1) In Arabidopsis thaliana, RNA directed DNA ...
| PowerPoint PPT presentation | free to view
... the major group of genes containing homeoboxes in Drosophila; engrailed ... the insulator scs is localized at interbands in Drosophila polytene chromosomes. ...
| PowerPoint PPT presentation | free to view
On the other hand, mouse embryonic stem ... (ME), neural progenitor cells (NPCs), and mesenchymal stem ... compared to that of MSC (19 22 days). For each cell ...
| PowerPoint PPT presentation | free to view
Working hypothesis (SALL4 in leukemic stem cells) Future Research Directions ... Normal and Leukemic Stem Cells. Grantsmanship and Research Support. Questions ...
| PowerPoint PPT presentation | free to view
Epigenetic connection between nutrients and cancer IFCC Advanced Summer School in Biochemistry and Molecular Cell Biology Epigenetics: Molecular Mechanisms, Biology ...
| PowerPoint PPT presentation | free to view
Canadian Bioinformatics Workshops www.bioinformatics.ca
| PowerPoint PPT presentation | free to view
Igk gene enhancer (Y. Bergman--Jerusalem) ... Imposes a cis-obligation on enhancers ... Very few proteins (outside of enhancer binding proteins) have been identified ...
| PowerPoint PPT presentation | free to download
V8 epigenetics during mamalian development Key feature of multi-cellular organisms: ability to develop specialized cells with specific functions.
| PowerPoint PPT presentation | free to view
... obesity , schizophrenia, Beckwith-Wiedemann syndrome, Alzheimer's disease ... Analyses of up- and down-regulated gene clusters ...
| PowerPoint PPT presentation | free to view
Vascular stem cells and progenitors Lipnik Karoline Department of Vascular Biology and Thrombosis Research Medical University of Vienna Lazarettgasse 19
| PowerPoint PPT presentation | free to download
The lac operon in action. When lactose is present, it acts as an inducer of the operon (turns it on) ... Figure 31-42b Attenuation in the trp operon. ...
| PowerPoint PPT presentation | free to view
Transcription regulation of complex loci
| PowerPoint PPT presentation | free to view
Histone H1 further condenses the DNA by binding the linker segments between the nucleosome core ... in the compaction and accessibility of eukaryotic and ...
| PowerPoint PPT presentation | free to view
Slugs contain two major cell types, prespore and prestalk. The slug contains multiple cell types ... labeled Pst cells in slug and culmination. regulation of ...
| PowerPoint PPT presentation | free to view
... extend the replicative lifespan of yeast and delay aging in C.elegans and D ... leads to the accumulation of ... into reactive oxygen species ...
| PowerPoint PPT presentation | free to download
noggin (TGFb superfamily) is sufficient to induce dorsal structures ... functions like noggin to block BMP factor interaction with receptors ...
| PowerPoint PPT presentation | free to view
Sanger: zebrafish. Broad Institute: mammals. Baylor College: cow. Washington University: chicken ... Zebrafish. Many duplications. Genome from different ...
| PowerPoint PPT presentation | free to view
Development of blood vessel system vasculogenesis, angiogenesis ... b.) adulthood: wound healing, menstrual. cycle, tumour-angiogenesis... Vasculogenesis ...
| PowerPoint PPT presentation | free to download
I will assign reading for each of the topics, starting with imprinting for ... Agouti mice: transposon inserted near agouti gene alters methylation leading to ...
| PowerPoint PPT presentation | free to view
The Institute for Molecular Bioscience
| PowerPoint PPT presentation | free to view
The relationship between self-renewal and clonal fate ... Jagged/Notch. Wnt/Frizzled:LRP. TGF. b / BMP-4. leptin. NGF. Shh/Patched. Angiopoietin/Tie-2 ...
| PowerPoint PPT presentation | free to view
Nematode worm consist of only about 1000 somatic cells and 1000-2000 germ cells. ... The organogenesis gaining the final shape of the differentiated organs ...
| PowerPoint PPT presentation | free to view
Bind cooperatively to adjacent sites ... Often, binding sites upstream of the ... Certain sites within Modules can be activated in a cooperative fashion and ...
| PowerPoint PPT presentation | free to view
| PowerPoint PPT presentation | free to view
mite. mites. jacobsoni. acarina. brood. parasite. colonies. host. control. chelicerata. chelicerates ... mite. mites. jacobsoni. acarina. brood. parasite ...
| PowerPoint PPT presentation | free to view
Drosophila Body Plan (part 2): Segmentation Drosophila Body Plan (part 2): Segmentation 5 3 anterior posterior Antennapedia complex has five homeobox genes Work ...
| PowerPoint PPT presentation | free to view
Tails of Intrigue: Phosphorylation of RNA Polymerase II Mediates Histone ... SET[Su(var)3-9, Enhancer of zeste (E(z)), and Trithorax]domain-containing. protein ...
| PowerPoint PPT presentation | free to view
rb-1 gene cloned 1986-87. Mutated or lost in all cases of retinoblastomas ... A and B are highly conserved from humans to plants, and they interact with each ...
| PowerPoint PPT presentation | free to view
lncRNA, Long non-protein-coding RNAs
| PowerPoint PPT presentation | free to download
Higher order DNA structure in eukaryotes does not allow for genomic access and ... Properties of PcG and TrxG proteins ... Post translational modification of histones ...
| PowerPoint PPT presentation | free to view
