Download Presentation File

File to download:

    Protein structure prediction PowerPoint PPT Presentation

Title: Protein structure prediction - PowerPoint PPT Presentation

Description: PSI-PRED secondary structure prediction based on PSIBLAST ... Strand(E), Helix(H) and Coil(C) AA: RLMPHIKRSAIPVNHGQCRWEDNVDERTNCMIQYVLIMRD ... – PowerPoint PPT presentation

Download instruction:

The PPT version of this presentation was uploaded from an external web page or resource. We
cannot guarantee that the PPT file is still there nor can we verify that it is safe for you to
download. That said, if you whish to download it, please copy the URL below, and paste it into
the address bar of your browser.

PPT URL:    https://www.cs.huji.ac.il/csls2002/seminar/LironEinat.ppt