Title: Fanconi Anemia Erica Antell
1Fanconi Anemia Erica Antell
2What is Fanconi Anemia?
- Fanconi anemia is one of the inherited anemias
that causes bone marrow failure. - It is a recessive disorder.
- There are at least 11 different mutations causing
fanconi anemia. - A, B, C, D1, D2, E, F, G, I, J, and L.
- It is considered mainly a blood disease.
- Many patients eventually develop acute
myelogenous leukemia at an early age. - Patients are very likely to develop squamous cell
carcinomas.
3Clinical Manifestations
Fanconi Anemia can be characterized by physical
abnormalities, bone marrow failure, and increased
risk of malignancy. Physical abnormalities of
affected individuals include short stature
abnormalities of the thumbs, forearms, skeletal
system, eyes, kidneys and urinary tract, ear,
heart, gastrointestinal system, oral cavity, and
central nervous system hearing loss
hypogonadism and developmental delay.
Progressive bone marrow failure with pancytopenia
typically presents in the first decade, often
initially with thrombocytopenia or leukopenia.
4Diagnosis and Treatment
- Patients are usually smaller than average.
- Blood tests may show a low WBC, RBC, and platelet
count. - Fatigue.
- Frequent infections.
- Frequent nosebleeds
- Easy bruising.
- Treatments include
- Bone marrow transplant.
- Growth factors.
- Hematopoietic (blood-stimulating) growth factors
are used to stimulate WBC production. - Androgens.
- Male hormones often stimulate the production of
RBCs and platelets.
5Mutation (Type A FA)
- Symbol FANCA
- Chromosome 16
- Location 16q24.3
- Gene Type protein coding
- When this mutation occurs, the incorrect protein
(FANCA) is transcribed as opposed to
the wild type, resulting in characteristics of
the fanconi anemia phenotype.
6Gene Structure
- By genomic sequence analysis, it was determined
that the FANCA gene contains 43 exons and spans
approximately 80 Kb. The exon size ranges from
34 to 188 bp. - Three alternative splicing events result in the
fanconi anemia mutation. They include - Loss of exon 37
- 23 bp deletion at the 5 prime end at exon 41
- GCAG insertion at the 3 prime end at exon 41
7Protein
- The protein responsible for Type A FA is titled
FANCA. - When one of the three previously mentioned
mutations occurs, the FANCA protein is
transcribed. - The transcription of this protein results in the
phenotype described earlier.
8Protein Structure
9DNA Sequence (FANCA gene)
atgtccgact cgtgggtccc gaactccgcc tcgggccagg
acccaggggg ccgccggagg gcctgggccg agctgctggc
gggaagggtc aagagggaaa aatataatcc tgaaagggca
cagaaattaa aggaatcagc tgtgcgcctc ctgcgaagcc
atcaggacct gaatgccctt ttgcttgagg tagaaggtcc
actgtgtaaa aaattgtctc tcagcaaagt gattgactgt
gacagttctg aggcctatgc taatcattct agttcattta
taggctctgc tttgcaggat caagcctcaa ggctgggggt
tcccgtgggt attctctcag ccgggatggt tgcctctagc
gtgggacaga tctgcacggc tccagcggag accagtcacc
ctgtgctgct gactgtggag cagagaaaga agctgtcttc
cctgttagag tttgctcagt atttattggc acacagtata
ttctcccgtc tttccttctg tcaagaatta tggaaaatac
agagttcttt gttgcttgaa gcggtgtggc atcttcacgt
acaaggcatt gtgagcctgc aagagctgct ggaaagccat
cccgacatgc atgctgtggg atcgtggctc ttcaggaatc
tgtgctgcct ttgtgaacag atggaagcat cctgccagca
tgctgacgtc gccagggcca tgctttctga ttttgttcaa
atgtttgttt tgaggggatt tcagaaaaac tcagatctga
gaagaactgt ggagcctgaa aaaatgccgc aggtcacggt
tgatgtactg cagagaatgc tgatttttgc acttgacgct
ttggctgctg gagtacagga ggagtcctcc actcacaaga
tcgtgaggtg ctga
10Conserved Domain for FA
gi 9837097 116 REELLIALFFFSLMGLLSSYLTQRDTAEHLKAVDI
CAEVLTCLERRKVSWLVLFQLTEKDAKLG 179 gi
12643546 1253 REELLVFLFFFSLMGLLSSHLTSNSTTDLPKAFHVC
AAILECLEKRKISWLALFQLTESDLRLG 1316
11References
- Thompson, E, Dragovic, RL, Campbell, IG. FANCA
Fanconi Anemia. PubMed. April 29, 2005. - Ferrer, M, Rodriguez, JA, Spierings, Ea, Kruyt,
FA. Identification of Multiple Export Sequences
Related to Fanconi Anemia. PubMed. March 24,
2005. - Alberts, Johnson, Lewis, Raff, Roberts, Walter.
Inherited Syndroms With Defects in DNA Repair.
Molecular Biology of the Cell. October 15,
2004. - Lodish, Harvey, Berk, Arnold. Peroxisomal
Protein Import is Defective in Some Genetic
Disorders. Molecular Cell Biology. July 23,
2003. - National Center For Biotechnology Information.
- PubMed.
- OMIM.