Title: CSE182-L4: Scoring matrices, Dictionary Matching
1CSE182-L4 Scoring matrices, Dictionary Matching
2Class Mailing List
- fa05_182_at_cs.ucsd.edu
- To subscribe, send email to
- fa05_182-subscribe_at_cs.ucsd.edu
- You can subscribe from the course web page
- Use the list for all course related queries,
discussions,
3Protein Sequence Analysis
- What can you do if BLAST does not return a hit?
- Sometimes, homology (evolutionary similarity)
exists at very low levels of sequence similarity.
- A Accept hits at higher P-value.
- This increases the probability that the sequence
similarity is a chance event. - How can we get around this paradox?
- Reformulated Q suppose two sequences B,C have
the same level of sequence similarity to sequence
A. If A B are related in function, can we assume
that A C are? If not, how can we distinguish?
4Protein sequence motifs
- Premise
- The sequence of a protein sequence gives clues
about its structure and function. - Not all residues are equally important in
determining function. - How can we identify these key residues?
5Prosite
- In some cases the sequence of an unknown protein
is too distantly related to any protein of known
structure to detect its resemblance by overall
sequence alignment. However, relationships can be
revealed by the occurrence in its sequence of a
particular cluster of residue types, which is
variously known as a pattern, motif, signature or
fingerprint. These motifs arise because specific
region(s) of a protein which may be important,
for example, for their binding properties or for
their enzymatic activity are conserved in both
structure and sequence. These structural
requirements impose very tight constraints on the
evolution of this small but important portion(s)
of a protein sequence. The use of protein
sequence patterns or profiles to determine the
function of proteins is becoming very rapidly one
of the essential tools of sequence analysis. Many
authors ( 3,4) have recognized this reality.
Based on these observations, we decided in 1988,
to actively pursue the development of a database
of regular expression-like patterns, which would
be used to search against sequences of unknown
function. -
- Kay Hofmann ,Philipp Bucher, Laurent Falquet and
Amos Bairoch - The PROSITE database, its status in 1999
6Basic idea
- It is a heuristic approach. Start with the
following - A collection of sequences with the same function.
- Region/residues known to be significant for
maintaining structure and function. - Develop a pattern of conserved residues around
the residues of interest - Iterate for appropriate sensitivity and
specificity
7Zinc Finger domain
8Proteins containing zf domains
How can we find a motif corresponding to a zf
domain
9From alignment to regular expressions
ALRDFATHDDF SMTAEATHDSI
ECDQAATHEAS
ATH-DE
- Search Swissprot with the resulting pattern
- Refine pattern to eliminate false positives
- Iterate
10The sequence analysis perspective
- Zinc Finger motif
- C-x(2,4)-C-x(3)-LIVMFYWC-x(8)-H-x(3,5)-H
- 2 conserved C, and 2 conserved H
- How can we search a database using these motifs?
- The motif is described using a regular
expression. What is a regular expression? - How can we search for a match to a regular
expression? Not allowed to use Perl -) - The regular expression motif is weak. How can
we make it stronger
11Profiles
- Start with an alignment of strings of length m,
over an alphabet A, - Build an A X m matrix F(fki)
- Each entry fki represents the frequency of symbol
k in position i
0.71
0.71
0.28
0.14
12Scoring Profiles
Scoring Matrix
i
k
fki
s
13Psi-BLAST idea
- Multiple alignments are important for capturing
remote homology. - Profile based scores are a natural way to handle
this. - Q What if the query is a single sequence.
- A Iterate
- Find homologs using Blast on query
- Discard very similar homologs
- Align, make a profile, search with profile.
14Psi-BLAST speed
- Two time consuming steps.
- Multiple alignment of homologs
- Searching with Profiles.
- Does the keyword search idea work?
- Pigeonhole principle again
- If profile of length m must score gt T
- Then, a sub-profile of length l must score gt
lT/m - Generate all l-mers that score at least lT/M
- Search using an automaton
- Multiple alignment
- Use ungapped multiple alignments only
15(No Transcript)
16CSE182-L6
- Regular Expression Matching
- Protein structure basics
17Zinc Finger domain
18The sequence analysis perspective
- Zinc Finger motif
- C-x(2,4)-C-x(3)-LIVMFYWC-x(8)-H-x(3,5)-H
- 2 conserved C, and 2 conserved H
- How can we search a database using these motifs?
- The motif is described using a regular
expression. What is a regular expression?
19Regular Expressions
- Concise representation of a set of strings over
alphabet ?. - Described by a string over
- R is a r.e. if and only if
20Regular Expression
- Q Let ?A,C,E
- Is (AC)EEC a regular expression?
- (AC)?
- AC..E?
- Q When is a string s in a regular expression?
- R (AC)EEC
- Is CEEC in R?
- AEC?
- ACEE?
21Regular Expression Automata
- Every R.E can be expressed by an automaton (a
directed graph) with the following properties - The automaton has a start and end node
- Each edge is labeled with a symbol from ?, or ?
- Suppose R is described by automaton A
- S ? R if and only if there is a path from start
to end in A, labeled with s.
22Examples Regular Expression Automata
C
A
E
E
start
end
C
23Constructing automata from R.E
?
- R ?
- R ?, ? ? ?
- R R1 R2
- R R1 R2
- R R1
?
?
?
?
?
24Regular Expression Matching
- Given a database D, and a regular expression R,
is a substring of D in R?
- Is there a string Dl..c that is accepted by the
automaton of R?
- Simpler Q Is D1..c accepted by the automaton
of R?
25Alg. For matching R.E.
- If D1..c is accepted by the automaton RA
- There is a path labeled D1Dc that goes from
START to END in RA
?
D1
D2
Dc
26Alg. For matching R.E.
- If D1..c is accepted by the automaton RA
- There is a path labeled D1Dc that goes from
START to END in RA - There is a path labeled D1..Dc-1 from START
to node u, and a path labeled Dc from u to the
END
u
D1 .. Dc-1
Dc
27D.P. to match regular expression
u
?
v
- Define
- Au,? Automaton node reached from u after
reading ? - Eps(u) set of all nodes reachable from node u
using epsilon transitions. - Nc subset of nodes reachable from START node
after reading D1..c - Q when is v ? Nc
?
u
Eps(u)
28D.P. to match regular expression
- Q when is v ? Nc?
- A If for some u ? Nc-1, w Au,Dc,
- v ? w Eps(w)
29Algorithm
30The final step
- We have answered the question
- Is D1..c accepted by R?
- Yes, if END ? Nc
- We need to answer
- Is Dl..c (for some l, and some c) accepted by R
31A structural view of proteins
32CS view of a protein
- gtspP00974BPT1_BOVIN Pancreatic trypsin
inhibitor precursor (Basic protease inhibitor)
(BPI) (BPTI) (Aprotinin) - Bos taurus (Bovine). - MKMSRLCLSVALLVLLGTLAASTPGCDTSNQAKAQRPDFCLEPPYTGPCK
ARIIRYFYNAKAGLCQTFVYGGCRAKRNNFKSAEDCMRTCGGAIGPWENL
33Protein structure basics
34Side chains determine amino-acid type
- The residues may have different properties.
- Aspartic acid (D), and Glutamic Acid (E) are
acidic residues
35Bond angles form structural constraints
36Various constraints determine 3d structure
- Constraints
- Structural constraints due to physiochemical
properties - Constraints due to bond angles
- H-bond formation
- Surprisingly, a few conformations are seen over
and over again.
37Alpha-helix
- 3.6 residues per turn
- H-bonds between 1st and 4th residue stabilize the
structure. - First discovered by Linus Pauling
38Beta-sheet
- Each strand by itself has 2 residues per turn,
and is not stable. - Adjacent strands hydrogen-bond to form stable
beta-sheets, parallel or anti-parallel. - Beta sheets have long range interactions that
stabilize the structure, while alpha-helices have
local interactions.
39Domains
- The basic structures (helix, strand, loop)
combine to form complex 3D structures. - Certain combinations are popular. Many sequences,
but only a few folds
403D structure
- Predicting tertiary structure is an important
problem in Bioinformatics. - Premise Clues to structure can be found in the
sequence. - While de novo tertiary structure prediction is
hard, there are many intermediate, and tractable
goals.
41Protein Domains
- An important realization (in the last decade) is
that proteins have a modular architecture of
domains/folds. - Example The zinc finger domain is a DNA-binding
domain. - What is a domain?
- Part of a sequence that can fold independently,
and is present in other sequences as well
42Proteins containing zf domains
How can we find a motif corresponding to a zf
domain
43Domain review
- What is a domain?
- How are domains expressed
- Motifs (Regular expression others)
- Multiple alignments
- Profiles
- Profile HMMs
44Databases of protein domains
45http//pfam.wustl.edu/ Also at Sanger
46PROSITE
http//us.expasy.org/prosite/
47(No Transcript)
48(No Transcript)
49http//hmmer.wustl.edu
50HMMER programs
- Hmmalign
- Align a sequence to an HMM
- Hmmbuild
- Build a model from a multiple alignment
- Hmmemit
- Emits a probabilistic sequence from an HMM
- Hmmpfam
- Search PFAM with a sequence query
- Hmmsearch
- Search a sequence database with an HMM query
51(No Transcript)
52Post-translational modification
- Residues undergo modification, usually by
addition of a chemical group. - Key mechanism for signal transduction, and many
other cellular functions - Some modifications might require single residues
(Ex phosphorylation). Others might require a
pattern
53(No Transcript)
54Protein targeting
55Protein targeting
- In 1970, Gunter Blobel showed that proteins have
an N-terminal signal sequence which directs
proteins to the membrane. - Proteins have to be transported to other
organelles nucleus, mitochondria, - Can we computationally identify the signal
which distinguishes the cellular compartment?
56- For transmembrane proteins, can we predict the
transmembrane, outer, and inner regions?
57(No Transcript)
58Multiple alignment tools
59Tools for secondary structure prediction
- Each residue must be
- given a state
- Helix, Loop, Strand
- HMMs/Neural
- networks are used to
- predict
60Next topic Gene finding